SecReT4
Protein ID: 188527637
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04295
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]838366..838965 [+]
Productcag pathogenicity island protein CagZ
Component typeCagZ
UniProt IDB2UTW2
KEGG IDhps:HPSH_04295
PDB IDNA
Domain hit(s) vs Pfam CagZ [PF09053], Evalue: 5.3e-138, Aligned region: 1..199
Protein Sequence: 199 a.a.     [Download]
>gi|188527637|ref|YP_001910324.1| cag pathogenicity island protein CagZ [Helicobacter pylori Shi470]
MELGFNEAERQKILDSNRSLMGNANEVRDKFIQNYATSLKDSNDPQDFLRRVQELRINMQKNFISFDAYY
NYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVVEISDNFNNFMCDEVAKISDLVASYLPREYLPPFI
DGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
 
Nucleotide Sequence: 600 bp     [Download]
>gi|209406223|ref|NC_010698.2|:838366-838965 Helicobacter pylori Shi470 chromosome, complete genome
ATGGAACTCGGTTTCAATGAAGCAGAAAGACAAAAAATCTTAGACAGCAACAGATCTCTTATGGGAAATG
CAAATGAAGTAAGGGATAAGTTTATTCAAAATTACGCCACTTCTTTAAAAGATAGCAACGATCCGCAAGA
TTTTTTGAGAAGAGTTCAAGAGTTAAGAATCAATATGCAGAAGAATTTTATTAGTTTTGATGCTTATTAC
AACTATTTGAACAACCTTGTGTTAGCCAGTTACAATCGTTGCAAACAAGAAAAGACTTTTGCAGAAAGCA
CGATCAAAAATGAACTAACGCTTGGGGAGTTTGTTGTAGAAATTTCTGACAACTTCAATAATTTTATGTG
TGATGAAGTGGCAAAAATTTCAGACCTAGTGGCTTCTTATCTGCCAAGAGAGTATTTACCGCCATTCATA
GATGGCAATATGATGGGCGTGGCGTTTCAGATTCTAGGGATAGATGATTTTGGAAGGAAGCTCAATGAGA
TTGTCCAAGATATAGGGACTAAATATATTATTTTGAGCAAAAATAAGACTTATCTCACTTCTTTAGAAAG
AGCTAAATTGATAACCCAATTAAAATTAAATTTGGAATAA
 Primer design