SecReT4
Protein ID: 188527638
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04300
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]838970..839962 [+]
Productcag pathogenicity island protein cag alpha
Component typeCagalpha
UniProt IDB2UTW3
KEGG IDhps:HPSH_04300
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-55, Aligned region: 36..317
DEAD [PF00270], Evalue: 7.5e-05, Aligned region: 161..224
Protein Sequence: 330 a.a.     [Download]
>gi|188527638|ref|YP_001910325.1| cag pathogenicity island protein cag alpha [Helicobacter pylori Shi470]
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLKNNGEWQPFDV
RDKKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSPVTVNDETISISIRIPSKTTY
PHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIMEFIPKEERIISIEDTEEI
VFKHHKNYTQLFFGGNITSADCLKSCLRMRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEA
FIRLANMSSSNNAARNIKFESLIEGFKDLIDMIVHINHHKQCDEFYIKHR
 
Nucleotide Sequence: 993 bp     [Download]
>gi|209406223|ref|NC_010698.2|:838970-839962 Helicobacter pylori Shi470 chromosome, complete genome
ATGACTGAAGACAGATTGAGTGCAGAAGATAAAAAATTTCTAGAAGTAGAAAGAGCTTTAAAAGAAGCGG
CATTAAATCCTTTAAGGCATGCTACTGAAGAACTTTTTGGTGATTTTTTAAAAATGGAAAATATCACTGA
GATTTGTTACAATGGGAACAAGGTTGTATGGGTTTTAAAAAATAATGGCGAATGGCAACCATTTGATGTG
AGAGACAAGAAAGCCTTTAGTTTATCTCGTTTAATGCATTTTGCTCGGTGTTGTGCAAGTTTTAAGAAAA
AAACAATAGACAACTATGAAAATCCTATTTTGAGTAGCAATTTAGCGAATGGTGAAAGGGTGCAAATTGT
CCTTTCCCCTGTTACAGTTAATGATGAAACCATTTCCATATCCATAAGGATACCTAGCAAAACAACCTAT
CCTCATAGCTTCTTTGAAGAACAGGGTTTTTATAATCTACTAGATAACAAAGAACAAGCGATCAGCGCGA
TTAAAGATGGTATTGCTATCGGTAAGAATGTGATTGTTTGTGGTGGCACAGGAAGCGGTAAAACGACTTA
TATCAAAAGCATCATGGAGTTTATCCCTAAAGAAGAAAGGATCATATCCATTGAAGACACCGAAGAGATT
GTATTCAAACACCACAAGAACTACACACAGCTTTTTTTTGGTGGGAATATCACCTCTGCTGATTGTTTAA
AGTCATGTTTGAGAATGCGACCTGATAGAATCATTTTAGGAGAACTCAGAAGCAGTGAGGCATATGATTT
TTATAATGTGCTTTGTAGCGGTCATAAAGGCACGCTAACCACTCTACATGCAGGGAGCAGTGAAGAAGCG
TTTATTCGTTTAGCCAACATGAGTTCATCTAATAACGCAGCAAGGAATATCAAGTTTGAAAGCCTCATTG
AGGGCTTTAAAGATTTAATTGATATGATTGTCCATATCAACCACCACAAACAGTGTGATGAATTTTATAT
CAAACATAGGTAG
 Primer design