SecReT4
Protein ID: 188527639
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04305
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]839971..842217 [+]
Productcag pathogenicity island protein Cag beta
Component typeCagbeta
UniProt IDB2UTW4
KEGG IDhps:HPSH_04305
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.4e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.5e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.8e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|188527639|ref|YP_001910326.1| cag pathogenicity island protein Cag beta [Helicobacter pylori Shi470]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKNFKEIIIEGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNKLPESDDDLFDIWIYAIQDFPAYYFKALCFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWESEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVYIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDENTNME
KVVSLMEFFGGEEDKSGDNLRVLSPATRNMWNNFKTMGGAKETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|209406223|ref|NC_010698.2|:839971-842217 Helicobacter pylori Shi470 chromosome, complete genome
ATGGAAGACTTTTTATATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTTCTCTACAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAACCAACCTCAAAAGAAAAAAAACTTTAAAGAAATCATTATAGAGGGGCTGAAAGAAAGAGTTAAAACC
TTTGGCTTTTGGTTACAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGACAATAAATTGCCTGAGAGTGATGATGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCGCTTTGTTTTAGTTCACTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATATTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGACATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAGAGCGAAGAAAAAATGATCAAAGCTAAACTTATCACACCCAATAATAAAAAACGCGCCTTT
GACAAACGAGAGGTTATTGTAGGCAGGCGTGGTTTAGGGGATTTTATCGCTTATGCAGGACAGGCGTTCA
TTGGCTTGATCGCTCCCACTAGAAGCGGTAAGGGTGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAGGCTGACACTATGGAAACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTATATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAACGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGTCA
TGGGATGGTGGCTAGTGGGGGGGATTTTTCCACTCAAATCTTTGGATTGGCTAAGTTGGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTTTTTAGCAATCAGGCGCGAAATCTTTTTGTCATTAATTGCAATATTT
ATAGGGATCTCATGTGGACTAAAAAGGGGCTTGAATTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCCACGATGTTTTTCATAGGTTCTATGGCGAGCGGTATCAATTTGATTGATGAAAACACAAACATGGAA
AAAGTTGTGTCTCTGATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGACAATCTAAGAGTGCTTA
GTCCTGCTACTAGAAACATGTGGAACAATTTCAAAACAATGGGTGGTGCTAAAGAAACTTACAGCTCTGT
TCAAGGGGTCTATACCTCAGCGTTTGCGCCTTACAATAATGCTATGATTAGGAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTGAGGATTGATGAAGTGAGTATTGGCGTGATCGCTAACCCTAAAGAAAGCA
CTATTGTTGGGCCGATATTAGAGCTGTTTTTCAATGTGATGATTTATAGCAACCTTATTCTGCCAATCCA
TGATCCACAATGCAAAAGAAGTTGTTTGATGCTTATGGATGAGTTCACGCTCTGTGGCTATTTAGAAACC
TTTGTGAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCTGCCTTTGTGTTTCAAAGTAAGGCGC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
AAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTGTTGGGG
AAATACACAAGGCAAGACGTGAGTCGAAGCATTGATGATAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACCATGGGCGATGAGCTTATCATTTTAGAAAA
CACGCTCAAACCCATCAAATGCCACAAGGCACTCTACTATGATGATCCGTTCTTCACCGATGAACTCATC
AAAGTGAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACTTTCTATGATG
ATTTGCAAGCCGCTAAAACTAGAGGCGAATTGAGCTATGACAAGTCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design