SecReT4
Protein ID: 188527640
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04310
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]842336..842716 [-]
Productcag pathogenicity island protein Cag gamma
Component typeCaggamma
UniProt IDB2UTW5
KEGG IDhps:HPSH_04310
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1e-05, Aligned region: 4..107
Protein Sequence: 126 a.a.     [Download]
>gi|188527640|ref|YP_001910327.1| cag pathogenicity island protein Cag gamma [Helicobacter pylori Shi470]
MVCRTLISIALLESSLGLNNKREISIKDTSYSMFHITLNTAKKFYPTYSKTLLKYKLLNDVDFAILLAKR
ILKENFDYYKQKHPDKSVYQIVEMAVGAYNGGMKHNPNGAYVKRFRCIYSQVRYNE
 
Nucleotide Sequence: 381 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c842716-842336 Helicobacter pylori Shi470 chromosome, complete genome
GTGGTGTGCAGAACGCTCATCTCTATCGCTTTATTGGAAAGTTCTTTAGGGTTGAACAACAAGCGCGAAA
TTTCTATTAAAGACACTTCCTATTCCATGTTTCACATCACCTTAAACACCGCTAAAAAATTCTACCCCAC
CTATTCTAAAACGCTCCTCAAATACAAATTGCTCAATGATGTGGATTTTGCGATTTTGTTGGCTAAAAGA
ATTTTGAAAGAAAATTTTGATTACTACAAACAAAAACACCCCGATAAAAGCGTGTATCAAATAGTAGAAA
TGGCAGTAGGCGCTTACAATGGGGGAATGAAACACAACCCTAATGGCGCTTATGTAAAGAGATTTCGTTG
CATTTATTCTCAGGTGCGATATAACGAGTAG
 Primer design