SecReT4
Protein ID: 188527641
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04315
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]842855..844300 [-]
Productcag pathogenicity island protein Cag delta
Component typeCagdelta
UniProt IDB2UTW6
KEGG IDhps:HPSH_04315
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|188527641|ref|YP_001910328.1| cag pathogenicity island protein Cag delta [Helicobacter pylori Shi470]
MFGKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINDNLPYAQATFLRVPKRSDPNAHTLDKGASIDENKLFEQQKRA
YFNYANDVICRPNDEVCSPLRDEMVAMPTSDSTTQKPNIIAPYSLYRLKETNNANETQPSPYAAQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLTEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPISPRTSNPDETMRVVKEKENYNGLLVDKETTIKRSYQGTLISENSYSKKTPINPNDLRSLEEEIKSYY
IKSNGLCYANGISLYVKIKNDPYKEGMLCGYESIQNLLSPLKDKLKYDKQKLQKALLKDLK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c844300-842855 Helicobacter pylori Shi470 chromosome, complete genome
ATGTTTGGAAAACTAGCAACCGCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATCATAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGCTTTTTGATATATACGACACCTTGAATGTGAATGATAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTATTGGATTACAACAACTA
TCTATCCATAGAAAACCCCATTATCAAAACAAGAGCGATGGGGACTTATGCGGATCTCATTATCATCACA
GGCTCACTAGAACAAGTCAATGGGTATTACAACATTTTGAAGGCGCTCAACAAACGAAACGCTAAGTTTG
TTCTAAAAATCAATGACAACCTGCCTTACGCCCAAGCGACTTTTTTGAGAGTTCCCAAAAGAAGCGATCC
CAATGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAGAATAAGCTTTTTGAACAACAAAAACGTGCG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAATGATGAAGTGTGTTCGCCCCTAAGAGATGAAA
TGGTAGCTATGCCCACTAGCGATAGCACTACTCAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAGACTCAACCATCACCTTATGCCGCTCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAACAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTGGAAGCAGAGTTGAAAAAGAAAAATGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTTCTCCTAGAACAAGTAATCCTGATGAAACAATGAGAGTTGTCAAGGAAAAAGAAAACTATA
ATGGATTGTTAGTGGATAAAGAAACCACGATCAAACGAAGCTATCAAGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAAACACCCATCAACCCTAATGACTTGAGAAGCTTAGAAGAAGAAATTAAGAGCTACTAT
ATTAAGTCTAATGGCTTGTGTTATGCTAATGGCATTAGTCTCTATGTGAAAATCAAAAACGACCCTTATA
AAGAGGGAATGTTGTGTGGTTATGAGAGTATTCAAAATCTGCTCTCACCTCTAAAGGACAAGCTCAAGTA
TGACAAGCAAAAGTTACAAAAAGCGTTACTGAAAGATTTAAAGTAA
 Primer design