SecReT4
Protein ID: 188527687
T4SS name [ID]VirB [605]
Gene symbol-
Locus tagHPSH_04545
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]897362..899089 [-]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDB2UU12
KEGG IDhps:HPSH_04545
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-68, Aligned region: 83..563
TrwB_AAD_bind [PF10412], Evalue: 1.5e-29, Aligned region: 323..542
TraG-D_C [PF12696], Evalue: 2.2e-24, Aligned region: 411..531
AAA_10 [PF12846], Evalue: 4.4e-10, Aligned region: 82..186
AAA_10 [PF12846], Evalue: 4.4e-10, Aligned region: 385..487
Protein Sequence: 575 a.a.     [Download]
>gi|188527687|ref|YP_001910374.1| conjugal transfer protein TraG [Helicobacter pylori Shi470]
MREKFKTLRDKFKDKTNNLFHKLNSIQKDYYTKTFPKACKDVFTLGSSKSYPMTLNFNKGFCVGLYKGLN
SLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLNVPSSCVVLDIKGELFDLTAGYRQQVLKNKIFVFDPL
GNDNTLKFNPFDKRIVEKLDFNRKRRLVDEVGNTIFAEDGTNKDPHWTQQAKNLFVFYALYDLCVHNTST
FFEIASAPIKNYVPLINPQSRFYTELYECQSSDNGFVKENGRYMAKVENGVKKMKPNVNVELLWYKQVAE
QVYTDPENPKNYDGSVNNLEKDDQGNVIMKEGMLDPVIRNEANKWAKANDKEFASIKSVYSRFMQVFTSY
QVKSATDSMSFEYEDLRADNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQSNALIEKYYGREDARIVNSTVAYKVIFKMDDLEYAKQVSEEVG
KMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIILVSGHKAKPLKLKANYYFKNKEL
LSRINWEVKPNEEVF
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c899089-897362 Helicobacter pylori Shi470 chromosome, complete genome
ATGAGAGAAAAATTCAAAACATTAAGAGATAAATTTAAGGATAAAACCAACAATTTATTCCATAAGCTTA
ATAGCATTCAAAAAGATTATTACACTAAAACTTTCCCTAAGGCTTGCAAAGATGTCTTTACGCTAGGTTC
TTCTAAGAGTTATCCTATGACCTTAAATTTTAACAAAGGTTTTTGTGTGGGGCTATATAAAGGTTTAAAT
TCACTTAAGCCTACTTATTATGATGCTCCGCTTTCTACTTTAATTATCGCTCCTCCTGGAAGTGGTAAAA
CCGCAGCTGTGGCTGTGCCTAATCTTTTAAATGTGCCTAGCTCTTGTGTGGTGTTAGATATTAAAGGGGA
GTTGTTTGATTTAACGGCTGGTTACAGACAACAAGTTCTAAAAAATAAAATTTTTGTATTTGATCCCTTA
GGAAATGATAACACGCTTAAATTCAATCCGTTTGATAAACGCATTGTAGAAAAATTAGATTTTAACAGAA
AGCGAAGGCTTGTAGATGAAGTGGGTAATACTATTTTTGCTGAAGATGGGACAAATAAAGACCCTCATTG
GACACAGCAAGCTAAAAATTTATTTGTCTTTTACGCTCTTTATGATTTGTGTGTGCATAACACTAGCACC
TTTTTTGAAATTGCAAGCGCTCCTATAAAAAATTATGTCCCCTTAATCAATCCACAAAGCCGATTTTATA
CTGAATTATATGAATGTCAAAGTAGTGATAATGGTTTTGTTAAAGAGAATGGGCGTTATATGGCTAAAGT
AGAAAATGGCGTTAAAAAAATGAAACCTAATGTCAATGTGGAATTGCTATGGTATAAACAAGTAGCCGAA
CAAGTCTATACTGACCCAGAAAATCCTAAAAATTATGATGGATCTGTGAATAATTTAGAAAAAGACGATC
AAGGCAATGTTATAATGAAAGAGGGCATGTTAGATCCTGTTATTAGAAACGAAGCGAACAAATGGGCTAA
GGCGAATGATAAAGAGTTTGCGAGCATTAAATCAGTTTATAGCCGTTTTATGCAAGTCTTTACAAGCTAT
CAAGTTAAAAGCGCTACAGATAGCATGAGTTTTGAATACGAGGATTTAAGGGCTGACAATATTTCACTCT
ATATTAAAATCGCTCAAACAGATATTGACACACTCGCACCGCTTATCCGTATCCTTTTGGAAAGTATTGC
TAAAAATCTTTTATTGAAAGAGAGTAAGAAATTTGAAGAAAGGGTTTATCTGTTTTTAGATGAATTTGTG
CGTTTTGGTAAATTGCCTTTTCTATTAGAAATGCCCGCATTAAGTAGGAGCTATGGTGTGGTTTTAATTT
TTATCACGCAATCCAACGCTCTTATTGAAAAATATTATGGTAGAGAAGATGCAAGAATTGTTAATAGCAC
CGTGGCTTACAAAGTAATTTTCAAAATGGATGATTTAGAATATGCTAAACAAGTGAGCGAAGAAGTCGGT
AAGATGACTAGAAAAACACGAAGCCACTCTACAGAAAAAGGACAACTCATTACCGGAGGAACTTCTAGTA
TAGGTAAAGAGGCGTGGGACTTATTGAGCGCGCAAGATATTATGAATATTGATAAAGATGAAGTGATCAT
TTTAGTAAGCGGTCATAAGGCTAAACCCTTAAAATTAAAAGCGAATTATTATTTCAAAAACAAAGAATTA
CTCTCTCGTATTAACTGGGAAGTCAAGCCCAATGAAGAAGTGTTTTGA
 Primer design