SecReT4
Protein ID: 188527691
T4SS name [ID]VirB [605]
Gene symbol-
Locus tagHPSH_04565
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]900387..901328 [-]
ProductVirB11 type IV secretion ATPase
Component typeVirB11
UniProt IDB2UU16
KEGG IDhps:HPSH_04565
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.6e-49, Aligned region: 14..290
Protein Sequence: 313 a.a.     [Download]
>gi|188527691|ref|YP_001910378.1| VirB11 type IV secretion ATPase [Helicobacter pylori Shi470]
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQLAIFRNQKFT
LKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLSEKCLAKNITHDFLLSLVSAG
KNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELKISNEDQVNILVDKSGSGFFTYEDGLNAAMR
MSPDRLLLGEIDTHNTALFLRLANTGHSGMISTLHANSVADAFIAICQNINLNKGGKPTPKETLLDYFCT
GMDYVIQIKKKGSDRIIDDVLNVKSEFKKELML
 
Nucleotide Sequence: 942 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c901328-900387 Helicobacter pylori Shi470 chromosome, complete genome
ATGATTTCTAATCTTTTAAAAAGTTACCTTGATGACTTTATGCCTATTTTAAGCCAGCCTAATTTAAATG
AAGTGGTTTTTAATAAAGAAAAAGAGTATTTCTTGCACCGCCCAAAGGAAAAAGTGAGGTGTTTTAATGA
AAAATTTACTAATGATTATTTGTTAGTTTTTTGTGAGCAATTAGCCATTTTTAGAAACCAAAAATTCACT
CTAAAAACGCCTAAGTTAAACACTTCTTTGCCTTACACACAAATTAGAATTAACGCATTACACCCTAGCA
TTATTGCTAGTTCTAATATTTCTATCAATATCAGAGTGCCTAGCAATTTCAAGTTTGAAATTAACGCCTT
TAAATTAAGTGAGAAATGTCTGGCTAAAAACATTACCCATGATTTTTTACTTAGCTTAGTAAGTGCAGGT
AAAAATATTTTAATAAGTGGTGGCACAGCTAGTGGCAAGACTAGCTTTGTTAATTCTTTGATTGAAAATA
TCCCCAAAAACGAAAGGGTGGTTACTATTGAAGATAGTCCTGAGTTAAAAATCAGTAACGAAGACCAAGT
TAATATTTTAGTAGATAAAAGTGGGAGCGGATTTTTTACTTATGAAGATGGATTAAATGCGGCTATGAGA
ATGTCTCCTGATAGATTATTATTAGGTGAAATTGACACGCATAATACTGCGTTATTTTTGCGTTTAGCAA
ATACTGGGCATAGCGGAATGATAAGCACCTTACACGCCAATAGTGTAGCAGATGCTTTTATAGCTATTTG
TCAGAATATAAACTTGAATAAAGGCGGTAAGCCTACGCCTAAAGAAACGCTTTTAGATTATTTTTGCACT
GGTATGGACTATGTTATCCAAATCAAAAAAAAAGGTAGTGATAGGATAATTGATGATGTTTTAAATGTTA
AAAGCGAATTTAAAAAGGAGTTGATGTTATGA
 Primer design