SecReT4
Protein ID: 188527698
T4SS name [ID]VirB [605]
Gene symbol-
Locus tagHPSH_04600
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]905016..906002 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDB2UU23
KEGG IDhps:HPSH_04600
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-27, Aligned region: 96..287
Protein Sequence: 328 a.a.     [Download]
>gi|188527698|ref|YP_001910385.1| hypothetical protein HPSH_04600 [Helicobacter pylori Shi470]
MEKVCMNAWELPKVLEERLKEKYGDDWEKYVKAKAINEEELEEQVKDKAKEQQKIQREKTLSGFLKKVGL
KKRDMLQSTMLFDGVKEADALFQAERKIGDWIFSSAVFFFALALIEAIIIICLLPLKEKVPYLVTFSNAT
QNFAIVQRADKSIRANQALIRQLVASYVNNRENISNIKEQNEIAHETIRLQSAFEVWDFFEKLVSYEHSI
YTNINLTRKISIINIALISKTQANIEISAQLFNKEKLESEKRYRIIMTFEFEPIEIDTKSVPLNPTGFIV
TGYDVTEIAILKDLDEKNKVKDDGVKSRIIHTEKKDPHMSQYKDVKEQ
 
Nucleotide Sequence: 987 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c906002-905016 Helicobacter pylori Shi470 chromosome, complete genome
ATGGAAAAAGTTTGCATGAACGCATGGGAGTTGCCTAAGGTTTTAGAAGAAAGATTAAAAGAAAAATATG
GCGATGATTGGGAAAAATATGTTAAGGCTAAAGCAATAAACGAAGAAGAGCTTGAAGAACAAGTCAAAGA
TAAAGCCAAAGAGCAACAAAAGATACAAAGAGAAAAAACACTCAGTGGATTTTTAAAAAAAGTTGGTCTA
AAAAAGCGTGATATGTTACAAAGCACTATGCTGTTTGATGGAGTCAAAGAAGCTGATGCGCTTTTTCAAG
CAGAGCGTAAAATTGGCGATTGGATCTTTAGCAGTGCGGTATTCTTTTTTGCTTTAGCTCTTATAGAAGC
CATTATTATTATATGCTTATTGCCCTTAAAAGAAAAAGTGCCTTATTTGGTAACCTTTTCAAACGCTACA
CAAAATTTTGCCATAGTCCAAAGAGCAGACAAGAGTATTCGTGCCAATCAAGCGCTTATAAGACAACTGG
TAGCATCTTATGTCAATAATAGAGAAAATATTTCAAATATAAAAGAGCAAAACGAAATAGCCCACGAAAC
CATTAGATTGCAAAGTGCATTTGAAGTATGGGATTTTTTTGAAAAACTTGTTTCCTATGAACATAGCATT
TACACTAATATCAATCTAACACGAAAAATTAGCATTATCAATATCGCTTTAATTAGTAAAACCCAAGCCA
ATATTGAAATATCCGCACAACTTTTTAATAAAGAAAAGTTAGAAAGCGAAAAGCGTTATAGAATAATTAT
GACCTTTGAATTTGAACCCATTGAAATTGATACAAAATCTGTTCCCTTAAATCCTACAGGCTTTATTGTT
ACAGGTTATGATGTAACTGAAATTGCGATTTTAAAAGACCTAGATGAAAAAAATAAAGTCAAAGATGATG
GTGTGAAATCTAGGATTATCCATACCGAGAAAAAAGACCCTCATATGAGCCAATATAAAGATGTTAAGGA
ACAATAA
 Primer design