SecReT4
Protein ID: 188527699
T4SS name [ID]VirB [605]
Gene symbol-
Locus tagHPSH_04605
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]906004..906132 [-]
Producthypothetical protein
Component typeVirB7
UniProt IDB2UU24
KEGG IDhps:HPSH_04605
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|188527699|ref|YP_001910386.1| hypothetical protein HPSH_04605 [Helicobacter pylori Shi470]
MVLKLVSICYAVIILMGCSNKQYEMYKSPCANLENPQKGFKA
 
Nucleotide Sequence: 129 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c906132-906004 Helicobacter pylori Shi470 chromosome, complete genome
ATGGTATTAAAACTTGTATCTATTTGCTATGCAGTCATTATTCTTATGGGTTGCTCCAATAAACAATATG
AAATGTATAAAAGCCCTTGCGCGAACTTAGAAAATCCACAAAAAGGCTTTAAGGCATAA
 Primer design