SecReT4
Protein ID: 188535921
T4SS name [ID]VirB [207]
Gene symboltraG
Locus tagETA_pET350100
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET35 [GenBank: NC_010696] [Browse all T4SS(s) in this replicon]
Location [Strand]7046..7849 [+]
ProductConjugal transfer protein TraG
Component typeVirB8
UniProt IDB2VAS6
KEGG IDeta:ETA_pET350100
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.7e-44, Aligned region: 56..264
Protein Sequence: 267 a.a.     [Download]
>gi|188535921|ref|YP_001909406.1| Conjugal transfer protein TraG [Erwinia tasmaniensis Et1/99]
MSLILTAIKKYKLKKSEREEIYSRNKNMAEISPSETKQLANDKTVHDHSIAGFQRDKVKDQRKLMWIGFG
FGGVGMVSAGAMAVALAALTPLKETKPYIASVDTVTGAISVVSAVGDEKIKLSYQNLIDANKLANFVVNR
ESYDWNSIQANLDEVKLNSTAGVYEAMRRFIVDSVNSPLQLLGKDKIMKVGIVSRPLVNSTNGTATVRFY
KAITDSSGKVIDGYPVTHWQATITFDYDHPLKTDDDKLYNPLGFNVTSYRVDQEVQK
 
Nucleotide Sequence: 804 bp     [Download]
>gi|188535911|ref|NC_010696.1|:7046-7849 Erwinia tasmaniensis Et1/99 plasmid pET35, complete sequence
ATGAGTTTAATATTGACAGCGATTAAAAAGTACAAACTAAAAAAGAGTGAGCGTGAAGAAATTTATAGCA
GAAATAAAAATATGGCTGAAATTTCCCCCTCCGAAACTAAACAATTAGCAAATGATAAAACAGTACATGA
CCATTCTATTGCTGGATTCCAACGCGACAAAGTAAAAGACCAACGCAAGTTAATGTGGATTGGTTTTGGA
TTCGGTGGGGTAGGTATGGTGTCGGCTGGAGCAATGGCGGTTGCACTGGCTGCACTAACACCGCTAAAGG
AAACGAAGCCTTACATTGCCAGCGTCGATACGGTTACAGGCGCAATCTCGGTTGTATCAGCCGTAGGCGA
TGAAAAAATCAAGCTTTCCTATCAAAACCTCATTGATGCAAATAAGCTTGCTAATTTTGTTGTTAACCGT
GAGTCGTATGATTGGAATTCGATTCAGGCTAACCTTGATGAAGTTAAACTTAATTCAACGGCTGGCGTGT
ATGAAGCGATGCGCCGTTTTATTGTTGATAGTGTCAATTCGCCCCTTCAATTGTTAGGTAAAGATAAAAT
AATGAAAGTGGGTATTGTTAGCCGCCCACTCGTGAATAGTACAAATGGAACAGCAACAGTACGTTTCTAC
AAAGCGATTACTGATAGTTCTGGAAAAGTGATTGATGGTTATCCGGTAACACACTGGCAAGCAACAATTA
CATTTGACTATGACCATCCGCTTAAAACTGATGATGATAAGCTATATAACCCGCTCGGATTTAACGTGAC
GAGTTATCGTGTGGATCAGGAAGTACAAAAATAA
 Primer design