SecReT4
Protein ID: 188535924
T4SS name [ID]VirB [207]
Gene symboltraJ
Locus tagETA_pET350130
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET35 [GenBank: NC_010696] [Browse all T4SS(s) in this replicon]
Location [Strand]9940..11013 [+]
ProductPutative conjugal transfer protein TraJ
Component typeVirB11
UniProt IDB2VAS9
KEGG IDeta:ETA_pET350130
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.1e-50, Aligned region: 19..327
Protein Sequence: 357 a.a.     [Download]
>gi|188535924|ref|YP_001909409.1| Putative conjugal transfer protein TraJ [Erwinia tasmaniensis Et1/99]
MDDYDDSFLARSKLKRTGITDLLNVDGITEVAVNQPGVIWFERGNGWESQISEQCNYGALADLAQALSVK
NNTGGIDSQWLNGKVNGVNSIHSVTLPDGERGQIILPPVTEQGKISITIRKPSKSRFTLQSYIDSGRLSN
YEICGKAFDKHRPLTHDQEEMLGLLRRGDTDRFFKKSVEMKLNHLMVGATGSGKTTFMKAVADLFPLNRR
YITMEDTHELDLPIHHNHVHLFFKREGQGVTAKDLIEAAMRMKPDHIYLTELRGDETWNYLGAINTGHNG
SLSSTHAEATPAGVFNRLTTLVKQSPIGSTLDYSLISNTVASTIDLITFWEGSYMKKVYYNPEEKNDAIN
RLLGMAA
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|188535911|ref|NC_010696.1|:9940-11013 Erwinia tasmaniensis Et1/99 plasmid pET35, complete sequence
ATGGATGATTACGATGATTCTTTTCTTGCCAGAAGCAAGTTAAAACGAACGGGTATCACAGATTTATTAA
ATGTTGATGGGATTACAGAAGTTGCGGTTAACCAGCCTGGTGTTATCTGGTTTGAGCGCGGTAATGGATG
GGAAAGTCAAATCAGCGAACAGTGCAATTATGGTGCGCTGGCTGATTTGGCACAGGCTTTATCTGTAAAA
AATAATACAGGTGGTATTGATAGCCAATGGCTTAATGGGAAAGTAAACGGTGTTAACTCAATTCATTCCG
TTACCTTACCAGATGGTGAAAGGGGGCAGATAATTTTACCTCCAGTTACTGAGCAAGGTAAAATATCCAT
AACAATCAGGAAACCCTCTAAATCACGGTTTACCTTGCAAAGCTATATAGATAGTGGGCGACTTAGTAAT
TATGAAATATGTGGAAAGGCTTTCGATAAGCATCGCCCATTAACGCATGATCAGGAGGAAATGCTAGGGC
TGTTAAGGCGTGGAGATACAGACCGTTTCTTTAAAAAAAGCGTTGAAATGAAATTGAATCATTTAATGGT
TGGGGCTACAGGGTCTGGTAAAACAACCTTCATGAAAGCGGTAGCTGACCTTTTTCCATTAAATCGCCGT
TATATCACGATGGAAGATACCCATGAGCTTGATTTGCCTATTCATCATAATCATGTGCATCTTTTCTTTA
AGAGAGAGGGGCAAGGGGTCACAGCTAAAGATTTGATTGAGGCGGCAATGCGTATGAAGCCGGATCACAT
CTATCTAACGGAGCTGCGCGGTGATGAAACATGGAACTATTTAGGTGCTATCAATACGGGACATAACGGT
AGTTTAAGTTCAACTCATGCAGAAGCTACGCCAGCAGGTGTTTTCAACAGATTGACCACGTTAGTTAAGC
AATCGCCAATCGGCTCTACGCTGGATTACAGTCTTATCTCTAATACAGTAGCAAGTACGATTGACCTGAT
AACCTTCTGGGAAGGTTCTTATATGAAAAAGGTTTATTACAATCCAGAAGAAAAAAATGATGCCATTAAC
CGCTTGCTTGGTATGGCAGCATAA
 Primer design