SecReT4
Protein ID: 188535925
T4SS name [ID]VirB [207]
Gene symboltraK
Locus tagETA_pET350140
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET35 [GenBank: NC_010696] [Browse all T4SS(s) in this replicon]
Location [Strand]11023..13074 [+]
ProductPutative conjugal transfer protein TraK
Component typeVirD4
UniProt IDB2VAT0
KEGG IDeta:ETA_pET350140
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.7e-89, Aligned region: 109..208
T4SS-DNA_transf [PF02534], Evalue: 4.7e-89, Aligned region: 240..648
TraG-D_C [PF12696], Evalue: 2.4e-25, Aligned region: 469..591
TrwB_AAD_bind [PF10412], Evalue: 1.1e-12, Aligned region: 386..600
Protein Sequence: 683 a.a.     [Download]
>gi|188535925|ref|YP_001909410.1| Putative conjugal transfer protein TraK [Erwinia tasmaniensis Et1/99]
MQPRKNITRGEVWLTIIFALFLSAALGVGGLYGGGYLFLLLSKVDTSILTYDTLIQSWKLWQYKKLHTPI
SIGTVAFILSMVLPFVGVIILGIFEFPEPDIHGNAKEITDDELEESGLLSTEQSKHPEILIGKVAKGRYK
GKFLKFDGQQFMGLGAPTRSGKGVGFVIPNLLNYRDSVCVLDIKAENFIMTAGYRKKMGQEIFVFAPDGY
RFSEDDYIQYKLSDHYLSMSEEEQKAFDERYFENAQVLTHRWNPLGYISRAKSRRVGDIEDIIAILFPDG
GGDNAIWNSMASSVFSGYVLYMLDMEKIVKDINAEIQSNRDNGVDDNREFMPAYPVTMAQMFTLTGVPDI
AAWMNDEILYWKEQGRPLSHETVEAFNRFTGVDVKTRGNIMQNFNQPLKVYQVESCMLATEANDFNFEDL
RKKRMSVYIVLSPSGIKKYGRLINLFFSQLVNVNTKELPEHNPELKYQCLLMLDEFTSMGRVEIIEKSIA
FTAGYDLRYMLIYQDDGQIESDEAYGKSGARVLKKNLALEVIYPPKTVDETADRVSKTFGTKTVKIKTRS
RTSSLGGGVSNGENEQYVKRDLYLPQEVVELGSVKYFSEIVKKNWLGLNRKIRKRTNLGVNEIIIMEQVK
PFVAHKIMYFDEPVFVKRKKIATDNIPEIPVLKEIKRFEMPRERRKDIPELSH
 
Nucleotide Sequence: 2052 bp     [Download]
>gi|188535911|ref|NC_010696.1|:11023-13074 Erwinia tasmaniensis Et1/99 plasmid pET35, complete sequence
ATGCAACCGAGAAAGAACATAACTCGCGGCGAAGTATGGTTGACGATAATCTTTGCATTATTCCTTTCTG
CGGCGTTGGGAGTAGGGGGGCTATATGGTGGAGGCTATTTATTTTTGCTTCTATCAAAAGTTGACACAAG
CATTCTTACATATGACACGCTAATTCAGTCTTGGAAGTTATGGCAGTATAAAAAACTTCATACTCCTATA
AGTATTGGCACTGTGGCTTTTATCCTCTCTATGGTACTGCCGTTTGTAGGTGTAATCATTTTAGGAATAT
TTGAATTTCCTGAGCCAGATATACATGGTAATGCCAAAGAAATTACTGATGATGAGTTAGAGGAAAGCGG
TTTGCTCTCGACAGAGCAAAGCAAGCATCCTGAAATTTTGATTGGGAAAGTGGCAAAGGGACGATACAAA
GGAAAGTTTCTTAAATTTGACGGACAGCAGTTTATGGGACTTGGCGCACCGACACGAAGCGGTAAAGGTG
TAGGGTTCGTTATCCCTAACCTGCTTAATTATCGTGATTCGGTTTGCGTTTTAGATATTAAAGCCGAAAA
CTTTATTATGACGGCTGGTTACAGAAAGAAGATGGGACAAGAGATTTTTGTTTTTGCTCCTGATGGTTAT
CGTTTCTCAGAAGATGATTATATTCAATATAAATTATCAGATCACTATTTGAGTATGAGTGAAGAGGAAC
AAAAAGCATTTGATGAACGGTATTTTGAAAATGCTCAGGTATTAACACACCGCTGGAATCCGCTAGGCTA
TATAAGTCGAGCTAAATCACGGCGTGTTGGTGATATTGAGGATATTATAGCAATCCTGTTTCCTGATGGC
GGTGGCGATAACGCTATATGGAATAGCATGGCTTCAAGCGTATTTTCAGGGTATGTACTTTATATGCTTG
ATATGGAAAAAATCGTTAAGGATATTAACGCAGAAATCCAGAGTAACAGAGATAATGGAGTTGATGATAA
CAGGGAGTTTATGCCCGCTTATCCTGTTACAATGGCGCAGATGTTTACGTTAACAGGTGTTCCAGATATT
GCGGCGTGGATGAATGATGAAATTCTCTACTGGAAAGAACAGGGGCGTCCTCTTAGCCATGAAACAGTAG
AAGCATTCAACCGCTTTACAGGTGTTGATGTTAAAACTCGCGGTAATATCATGCAGAACTTCAATCAGCC
GCTTAAAGTTTATCAAGTTGAGTCATGTATGCTTGCTACTGAGGCAAATGATTTTAACTTTGAAGATTTG
CGTAAAAAACGTATGTCGGTTTATATAGTTCTTTCTCCTTCTGGCATTAAAAAATACGGCAGGTTGATTA
ATTTATTCTTTAGCCAGTTGGTTAACGTAAATACAAAAGAACTTCCAGAGCATAATCCAGAACTAAAATA
CCAATGTCTATTGATGCTCGATGAGTTTACATCAATGGGGCGTGTGGAAATCATTGAAAAGTCAATAGCA
TTTACGGCTGGTTACGATCTGCGATACATGCTGATTTATCAGGATGATGGGCAGATAGAAAGTGATGAGG
CTTACGGTAAATCAGGTGCTAGGGTTCTTAAAAAGAACCTTGCTTTAGAAGTTATTTATCCGCCTAAGAC
GGTCGATGAGACAGCAGACCGCGTAAGTAAAACGTTTGGTACAAAAACTGTCAAAATTAAAACCAGAAGC
CGCACAAGTTCACTTGGTGGAGGGGTTAGTAATGGTGAAAACGAGCAGTATGTAAAACGTGATTTGTACC
TGCCTCAAGAAGTTGTTGAATTGGGATCAGTTAAATACTTTTCTGAGATAGTTAAGAAAAACTGGCTGGG
TCTTAACCGGAAAATCAGAAAGCGTACTAACTTAGGTGTTAATGAAATAATTATAATGGAGCAGGTTAAA
CCATTTGTAGCTCATAAAATAATGTATTTTGATGAACCTGTATTTGTTAAAAGAAAAAAAATAGCAACTG
ATAATATTCCAGAGATTCCAGTTCTCAAGGAAATTAAGCGGTTTGAAATGCCACGCGAAAGGCGCAAAGA
TATTCCTGAGTTGTCACATTAA
 Primer design