SecReT4
Protein ID: 188535964
T4SS name [ID]Tra_F [131]
Gene symboltraL
Locus tagETA_pET450100
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET45 [GenBank: NC_010699] [Browse all T4SS(s) in this replicon]
Location [Strand]5061..5363 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB2VB06
KEGG IDeta:ETA_pET450100
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.4e-27, Aligned region: 6..100
Protein Sequence: 100 a.a.     [Download]
>gi|188535964|ref|YP_001911076.1| conjugal transfer pilus assembly protein TraL [Erwinia tasmaniensis Et1/99]
MSGTFDKYTFPETINEQNRIFGLPVDEVAVIATPVICGVAYSCAGAMCLLAALLWVLLRYLKKGKGSQFM
ADFLYWNLPYFLFRPFFRKIPSSGNRHWVN
 
Nucleotide Sequence: 303 bp     [Download]
>gi|188535954|ref|NC_010699.1|:5061-5363 Erwinia tasmaniensis Et1/99 plasmid pET45, complete sequence
ATGTCCGGGACATTTGATAAATATACTTTCCCGGAGACGATAAACGAACAAAACCGCATTTTCGGCTTGC
CAGTCGATGAAGTCGCAGTGATTGCAACGCCAGTTATCTGTGGCGTTGCCTATTCTTGTGCAGGCGCTAT
GTGTTTGCTGGCTGCCTTATTGTGGGTGCTTCTTCGTTATCTGAAGAAAGGGAAAGGTTCTCAGTTTATG
GCTGATTTTCTGTACTGGAATCTTCCCTACTTTTTATTTAGACCATTCTTCAGAAAAATCCCGTCTTCTG
GAAATAGGCATTGGGTGAATTAA
 Primer design