SecReT4
Protein ID: 188535975
T4SS name [ID]Tra_F [131]
Gene symboltraF
Locus tagETA_pET450210
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET45 [GenBank: NC_010699] [Browse all T4SS(s) in this replicon]
Location [Strand]15777..16565 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB2VB17
KEGG IDeta:ETA_pET450210
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7e-71, Aligned region: 34..252
Protein Sequence: 262 a.a.     [Download]
>gi|188535975|ref|YP_001911087.1| conjugal pilus assembly protein TraF [Erwinia tasmaniensis Et1/99]
MARCALVGFISACFVFSNMVMADEVIDGEKPFTGWHWYNEPVNKYEAKKNEKPKSDIADISKMPIQEQVK
VLQGYTKDALATAILYPHDIEANASFQRWQKFWTDHAGYFSQAFSVAQLKYPDLDYNLEHSHYNSIASLE
SAKQQSNEDKAIQKIAENYGLFLFYRGSDPVDTQMAGVVSAFAKAKNISIVPISVDGVVASTLPETRPDT
GQSKAMRITHYPALYLVEPKSRKYEPVAYGFMTQDDLATRFMYVATGFKPNF
 
Nucleotide Sequence: 789 bp     [Download]
>gi|188535954|ref|NC_010699.1|:15777-16565 Erwinia tasmaniensis Et1/99 plasmid pET45, complete sequence
ATGGCTAGGTGTGCTCTCGTTGGTTTTATTTCTGCGTGTTTTGTTTTTTCAAACATGGTGATGGCAGATG
AAGTTATTGATGGTGAAAAACCTTTTACGGGCTGGCACTGGTATAACGAGCCAGTCAATAAATATGAGGC
TAAAAAAAATGAAAAGCCAAAAAGTGACATTGCCGATATAAGCAAAATGCCGATTCAGGAACAGGTTAAG
GTTTTACAAGGATATACAAAGGATGCGCTGGCAACGGCCATCCTTTATCCACACGATATAGAGGCGAATG
CATCATTTCAGCGCTGGCAAAAATTCTGGACAGATCACGCGGGTTATTTTTCACAGGCGTTTTCTGTAGC
GCAGCTTAAATATCCTGACCTGGACTATAACCTTGAACACAGCCATTACAATTCTATTGCCAGTCTGGAA
TCAGCTAAACAGCAAAGTAATGAAGATAAGGCAATTCAGAAAATAGCCGAGAATTACGGCCTGTTTCTCT
TTTATCGAGGAAGCGACCCGGTGGATACACAGATGGCGGGTGTAGTTTCCGCATTCGCGAAGGCAAAAAA
TATTTCCATCGTTCCAATCAGCGTTGATGGCGTGGTCGCAAGCACGCTGCCGGAAACTCGCCCGGACACC
GGGCAGTCAAAAGCGATGCGCATTACGCATTACCCCGCACTTTATCTGGTTGAACCTAAAAGCCGGAAAT
ATGAGCCAGTGGCCTATGGCTTTATGACGCAAGACGATCTTGCCACCCGCTTTATGTATGTAGCAACTGG
CTTTAAACCCAACTTCTGA
 Primer design