SecReT4
Protein ID: 188573904
T4SS name [ID]Tra_F [94]
Gene symboltraF
Locus tagEc53638_A0439
StrainEscherichia coli 53638 plasmid p53638_226 (NC_010719)
Repliconplasmid p53638_226 [GenBank: NC_010719] [Browse all T4SS(s) in this replicon]
Location [Strand]86363..87100 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB2U5Q2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.2e-76, Aligned region: 23..235
Protein Sequence: 245 a.a.     [Download]
>gi|188573904|ref|YP_001919174.1| type IV secretion-like conjugative transfer system pilus assembly protein TraF [Escherichia coli 53638]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAILY
PGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQVQQRQAIAKLAE
HYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLV
DPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 738 bp     [Download]
>gi|188573899|ref|NC_010719.1|:c87100-86363 Escherichia coli 53638 plasmid p53638_226, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCGGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAATAAACCTGTACCTGCAGCCCCACGTCAGGAGCC
GGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCTATTCTGTAT
CCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCA
CCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCATTACAA
CGGCACGGTCCGGAACCAGCTGGCGGCAGACCAGGTGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAA
CACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATG
GCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCC
GGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTT
GACCCGAAACAGGGCAGTGTTCGTCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAAAACAAT
TCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design