SecReT4
Protein ID: 188573950
T4SS name [ID]Tra_F [94]
Gene symboltraX
Locus tagEc53638_A0424
StrainEscherichia coli 53638 plasmid p53638_226 (NC_010719)
Repliconplasmid p53638_226 [GenBank: NC_010719] [Browse all T4SS(s) in this replicon]
Location [Strand]69337..70083 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB2U5N7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 1.2e-51, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|188573950|ref|YP_001919159.1| type IV secretion-like conjugative transfer system pilin acetylase TraX [Escherichia coli 53638]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSNRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVLCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|188573899|ref|NC_010719.1|:c70083-69337 Escherichia coli 53638 plasmid p53638_226, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CATTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTT
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCAGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATACTCCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGTATTGCCGGGTTGCTGATGC
TGGCAGTCAGCAACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTTGTGTGCCGGAAAATCATTACCCCGTTTCTGGCCCGGAGACTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTACTGGGCGTTCTGGCGCTGTGA
 Primer design