SecReT4
Protein ID: 188573968
T4SS name [ID]Tra_F [94]
Gene symboltraL
Locus tagEc53638_A0127
StrainEscherichia coli 53638 plasmid p53638_226 (NC_010719)
Repliconplasmid p53638_226 [GenBank: NC_010719] [Browse all T4SS(s) in this replicon]
Location [Strand]99349..99660 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB2U5R9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|188573968|ref|YP_001919191.1| type IV secretion-like conjugative transfer system protein TraL [Escherichia coli 53638]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|188573899|ref|NC_010719.1|:c99660-99349 Escherichia coli 53638 plasmid p53638_226, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTCCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design