SecReT4
Protein ID: 188574075
T4SS name [ID]Tra_F [94]
Gene symboltraQ
Locus tagEc53638_A0437
StrainEscherichia coli 53638 plasmid p53638_226 (NC_010719)
Repliconplasmid p53638_226 [GenBank: NC_010719] [Browse all T4SS(s) in this replicon]
Location [Strand]85597..85881 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB2U5Q0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|188574075|ref|YP_001919172.1| type IV secretion-like conjugative transfer system pilin chaperone TraQ [Escherichia coli 53638]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|188573899|ref|NC_010719.1|:c85881-85597 Escherichia coli 53638 plasmid p53638_226, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design