SecReT4
Protein ID: 188574177
T4SS name [ID]Tra_F [93]
Gene symboltraU
Locus tagEc53638_A0102
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]63074..64066 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDB2U6F3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.2e-83, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|188574177|ref|YP_001919425.1| type IV secretion-like conjugative transfer system protein TraU [Escherichia coli 53638]
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPVQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFCHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGQVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|188574176|ref|NC_010720.1|:63074-64066 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCGGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCGTTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGACTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTGAACGGGGCGTTCTGTCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTTAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATTGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGGGCCTGTGCAGCAGATGCCATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTACCCGTTCAATGGCCAGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTATCCGGACAGCGGACAGTGCCACCCGTTCGGGCGCAGCGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTATTCCTGTAA
 Primer design