SecReT4
Protein ID: 188574188
T4SS name [ID]Tra_F [93]
Gene symboltraC
Locus tagEc53638_A0099
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]59435..62065 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDB2U6F0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.1e-58, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 5.4e-43, Aligned region: 480..773
DUF87 [PF01935], Evalue: 3.2e-05, Aligned region: 483..670
TrwB_AAD_bind [PF10412], Evalue: 5.6e-05, Aligned region: 480..518
Protein Sequence: 876 a.a.     [Download]
>gi|188574188|ref|YP_001919422.1| type-IV secretion system protein TraC [Escherichia coli 53638]
MNNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLVRNPEIAL
LWNMADNYSNLLNPELSISCPFILTLTLMVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSAVVSYFLNITAFCNDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKKNRARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQY
TANGTYGRYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAARDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|188574176|ref|NC_010720.1|:59435-62065 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAATAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACCGCACTGAAACTGCCTG
ACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTA
CCGTGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATT
CCCATCAATGGTGCGAATGAGTCCATTGTGGAGGCTCTCGATCATATGCTGCGCACTAAACTGCCGCGCG
GTATTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAATACGGGCTGCGTGA
GTTCTCCTGGTCAGGTGAACAGGCCGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCA
GCGACACAGTTTCCGCTGCCGGAGGGAATGAATCTGCCCCTGACCCTGCGGCATTACCGGGTGTTTTTCT
CGTACTGTTCTCCCTCAAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCAT
CCGGGCGTCATTACAGGGGGCCAGTATCGCCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTC
GGGGAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATC
TGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCTGCG
TGAGAACGGCAGGAACAGCACGGCCCGTATCCTGAATTTCCATCTGGTCCGTAATCCGGAAATCGCCTTA
CTGTGGAATATGGCCGACAACTACAGCAACCTGCTTAACCCGGAACTGTCCATCTCCTGCCCGTTCATCC
TGACGCTGACCCTGATGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCT
GGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGG
GAACTGCGTCAGCGGCTGGGCTCCGGTCAGTCTGCTGTCGTGTCCTACTTCCTCAACATCACAGCATTCT
GCAATGACAATAATGAAACGGCACTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTT
TGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGCCTGCCCTTTATGGCCGGGAAA
GGACTGTTTAAACAGCTGAAAGAGGCCGGTGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGA
TGCCGTTAGTGGCGGATAATCCCCTGACACCGGCAGGTCTGCTGGCCCCCACCTACCGTAACCAGCTGGC
GTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCTGTCTGTGGCACCTCCGGG
GCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCTGGGGGCTTTGCCGTGGTGT
TCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGGGGGCGTATATCTGGACGGTGAAACCCT
GCGCTTTAATCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTTCGCGACCAGTTGTCG
GTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAGGGTCTGTTGCTGCAGGCGGTCAGGGCAT
CATGGCTGGCCAAAAAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCCGTGATAA
CGACCAGTATGTCGAGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTCCTGCTGGATCAATAT
ACCGCCAACGGCACTTACGGCCGGTATTTTAACTCTGATGAACCGTCCCTGCGGGATGATGCGAAAATGG
TGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCCCTGCTGGTTGCGGTGATGTTCAGCCTCATTAT
TTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAAAAACTGAACGTTATTGATGAAGGCTGG
CGTCTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGTTACCGTACCGCCCGCCGTC
ATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGACAAGGCATCCAGTGCTGC
CCGTGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATAC
AACCAGCTGTATCCGGACCAGTTCCAGCCATTGCAGCGGGACATGATTGGTAAGTTTGGTGCGGCCAGAG
ACCAGTGGTTCAGTTCCTTCCTGTTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGACCC
GTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAACGTAAAGAGGGG
CTGAGTATTCATGAGGCGGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAG
CCTGGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA
 Primer design