SecReT4
Protein ID: 188574189
T4SS name [ID]Tra_F [93]
Gene symboltraN
Locus tagEc53638_A0105
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]65045..66853 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB2U6F6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.9e-73, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|188574189|ref|YP_001919428.1| type IV secretion-like conjugative transfer system mating-pair stabilization protein TraN [Escherichia coli 53638]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVDAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFRRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGKSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
DKLTVSVGEFCSKKVPGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|188574176|ref|NC_010720.1|:65045-66853 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATCACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCCGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATTACCTCTCCCGTTACCGGTGAAATTGTCGATGCGCATTACAGC
TGGAGTCGTACTTACCTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTTGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAGACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGATGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACGCAGTCAGCAGACAAGGGAACC
TGTCAGACCTACACCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGCGCCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGCGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTTGATGGCGAATGCGATAAGGCTCAGAGCGGGAAGAGTAATGATTTTGCCGAA
GCTGTTTCTCAGCTGGCAGCACTGGCCGCTGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCGGCAGCCGGATACAGCAATTGCTGTAAGGACAG
CGGCTGGGGGCAGGATATCGGGCTGGCTAAATGCAGCAGTGATGAAAAAGCCCTGGCTAAAGCAAAATCA
GACAAACTGACCGTTAGTGTCGGAGAGTTCTGTTCGAAGAAAGTGCCGGGTGTCTGTCTGGAGAAAAAAC
GCAGCTACTGTCAGTTTGATTCGAAACTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGTCAGTTGCG
TATCAGTTTTGGCAGTGCGAAGCATCCTGACTGTCGGGGAATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCGACAGACTGGATTTCACTAACTTTTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGTG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design