SecReT4
Protein ID: 188574191
T4SS name [ID]Tra_F [93]
Gene symboltraF
Locus tagEc53638_A0107
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]67130..67873 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB2U6F8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.3e-79, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|188574191|ref|YP_001919430.1| type IV secretion-like conjugative transfer system pilus assembly protein TraF [Escherichia coli 53638]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAVLQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSARKVMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|188574176|ref|NC_010720.1|:67130-67873 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCAGTACCTGCAGCCCCCCGTCA
GGAGCCGGATATTATGCAGAAACTGGCCGTGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAAAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAGAAAGGTCATGCTGGCACATCCTGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTCCGGAACCAGCTGGCGGCGGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGGAGTGTTCGTCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAA
AACAATTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design