SecReT4
Protein ID: 188574220
T4SS name [ID]Tra_F [93]
Gene symboltraW
Locus tagEc53638_A0101
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]62445..63077 [+]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDB2U5Q7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 1..30
Protein Sequence: 210 a.a.     [Download]
>gi|188574220|ref|YP_001919424.1| type IV secretion-like conjugative transfer system protein TraW [Escherichia coli 53638]
MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRP
PAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKR
QTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|188574176|ref|NC_010720.1|:62445-63077 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAGATGCCGGGGGCTGATTGCCCTGCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGCACCT
GGGGCGATCTGTGGCCGGTAAAGGAGCCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGA
GCAGTCCGGTGAGATGGGCCGGAAAATGGATGCCTTTAAGGAGCGGGTGATCCGCAACAGCCTGCGGCCC
CCTGCCGTGCCCGGTATCGGACGCACGGAGAAATACGGCAGTCGGTTGTTTGACCCGTCCGTCAGACTGG
CTGCGGATATCCGGGATAACGAAGGGCGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTA
TGTGCCTTTTAACCAGACGCTGTATTTCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGC
CAGACGCCGCCCACACTGGAGAGCAAAATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAGTCTC
TGGACAGCCGTGTTTACTTTGACCAGAACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGC
ACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAA
TGA
 Primer design