SecReT4
Protein ID: 188574223
T4SS name [ID]Tra_F [93]
Gene symboltraD
Locus tagEc53638_A0013
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]121..2364 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDB2U674
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.3e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 1.6e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.2e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 8.9e-08, Aligned region: 382..476
Protein Sequence: 747 a.a.     [Download]
>gi|188574223|ref|YP_001919346.1| type IV conjugative transfer system coupling protein TraD [Escherichia coli 53638]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGRDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQERPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPQQPQQPVSPVINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESG
EVVDMAAYEAWQQENHPDTWQQMQRREEVNINVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2244 bp     [Download]
>gi|188574176|ref|NC_010720.1|:121-2364 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAAGGCATGCGG
GATTTAATCAGGTCCCAGCCGGTATATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAATGCTGCTC
AGGTACTGCATGATAAATATATGATCTGGTGCGGAGAGCAGCTATGGTCCGCATTCGTTCTGGCCACAGT
TGTGGCACTGGTTATTTGCCTGATTACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAGGGACTCCGATATCCGGATTGGCGATCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGTGGTGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAGATCCTGAATCCGCTGGATGCACGCTGTGCCGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCAAATACTCTGATCCCGATGGGCACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTATCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAACTGCGTACCTACCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATCGAGAAAACGGCCATCTCCATCCGTGCTGTGCTGACCAACTATGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAGGATCAGAAAAACGGCTGGCTGTTTATCTCGTCGAATGCCGACACTCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAATCGTCGTGTG
TGGTTCTTCTGTGATGAGTTACCCACATTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGCTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCG
GAGTTCGCTGCCGGTGAAATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAACAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCCCTGCCGGATCTGACCTGCTATGTCACCCTGCCCGGACCGTATCCGGCAGTCAAACTCTCACTG
AAATATCAGGAACGTCCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTCGAACCGGATGT
CCCGGAGGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGCAACAGCCGCAACAG
CCGCAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCGCAAC
AGCCGGTGTCTCCTGTCATCAACGATAAGAAGTCAGATTCAGGTGTGAATGTTCCGGCAGGGGGGATCGA
GCAGGAGCTGAAAATGAAACCGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGT
GAAGTGGTGGATATGGCCGCTTATGAGGCATGGCAGCAGGAAAATCATCCGGACACCTGGCAGCAGATGC
AGCGTCGTGAAGAGGTGAACATCAATGTGCACCGGGAACGCGGGGAGGATGTTGAGCCGGGAGATGATTT
CTGA
 Primer design