SecReT4
Protein ID: 188574226
T4SS name [ID]Tra_F [93]
Gene symboltraI
Locus tagEc53638_A0016
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]3080..8350 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDB2U677
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 3.7e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 9.6e-42, Aligned region: 968..1156
AAA_19 [PF13245], Evalue: 1.3e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|188574226|ref|YP_001919349.1| type IV secretion-like conjugative transfer relaxase protein TraI [Escherichia coli 53638]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIEAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVTNVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVAQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVTERVTAQSHSLTLRNAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVSDSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFADLGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAVGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMQKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGQVQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDTIRVGSGDRMRFTKSDRECGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQEQAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTPGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|188574176|ref|NC_010720.1|:3080-8350 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAATTATTATACCGACAAGGATAATTACT
ATGTGCTGGGCAGCATGGGAGAACGCTGGGCCGGCCAGGGGGCTGAACAACTGGGGCTGCAGGGCAGTGT
CGATAAGGATGTCTTTACCCGCCTTCTGGAGGGCAGGCTGCCGGACGGGGCGGATTTAAGCCGCATGCAG
GATGGCAGTAACAGGCATCGTCCCGGCTACGACCTGACCTTCTCCGCTCCCAAAAGTGTCTCCATGATGG
CCATGCTCGGGGGGGACAAACGTCTTATTGAAGCACATAACCAGGCCGTGGATTTTGCTGTCCGTCAGGT
GGAGGCACTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTGCTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGACTA
ATGTTACGCAGCATAACGGCGAATGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACTGAAGTGGTTGGTAAGCACGGTATGTGGGAAATGCCGGGCGTACCGGTGGAGGCCT
TTTCCGGACGCTCGCAGACTATCCGGGAGGCCGTCGGGGAGGACGCCTCGTTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCGTATCGTGACGCGGCGGATCAGCGTGCGGAGATCCGCACGC
AGGCGCCCGGGCCTGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGGCACAGGCCATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTCACGTACACGGACGTGCTGGCCAGAACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTTG
ACCGTGAAAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGT
GATGCCGTCAGTGTTCTGGCACAGGACCGTCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAAGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAGCTGATAACCGGACGT
CGTCAGCTGCTGGAAGGCATGGCCTTCACGCCGGGCAGTACCGTTATCGTCGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGATGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCACTGATGGCCATGAAGGATGCCGGGGTGAACACATATCGCTGG
CAGGGGGGAGAACAGCGACCGGCCACCATCATCAGTGAACCGGACCGTAATGTCCGCTATGCCCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGTGTGGCACAGGTCAGCGGAGTACGGGAACA
GGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACACCCGGAGGTAACC
ATGACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGCCCGGGAA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTGACAGAACGTGTGACGGCGCA
GAGTCACAGCCTGACCCTGCGGAATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCTTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGTGAGCGTCTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGACGGGCTGAACCGGCCACCCTGCCTGTGAGCGATTCACCGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGACGGTTTTTGCCTCCGTCACAC
AGATGGCAATGGACAATGCCACCCTGAACGGTCTGGCCCGCAGTGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGTGCCGGTGAGACATTGCTGGAAACCGCTATCAGTCTGCAGAAAGCCGGGCTTCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCGGTTTTGCTGACCTGGGAGGGGAAATCAATGCG
CAGATAAAACGGGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAGAGCATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCTGGCGAACTCATGGAGAAACTGACATCAGGACAGCGCGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTGCAGGGCTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAACGTCCCCGTGTCGTGGGGCTGGGGCCCACACA
CCGTGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCACAGACACTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGTAACACCGACATGGCACGGGCATACGCCCTGATTGCGGTCGGTGGCGGTCGGGCTGTGGCCAG
CGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCCTTCCGTCTGCAGCAGACGCGCAGTGCT
GCCGATGTGGCCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCACGTCTGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAGGCG
CAGCAGAAGGCGATGCAGAAAGGCGAGGCTTTTCCGGATGTCCCCATGACACTGTATGAGGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGAGAACTGGGGCAGGTGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGCGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGACACATC
GGGACGCACTTGCCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGTAAGGATGACGGGCTGAT
AACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGCGTCACA
CTGTACACTCCGGACACCATCCGGGTGGGGAGCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGT
GCGGCTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGCTGTCGGACGG
ACAGCAGACCCGGGTGATTCGCCCCGGCCAGGAGCAGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCTCACGGTGCGCAGGGGGCAAGTGAAACCTTTGCCATTGCGCTTGAAGGCACGGAAGGTAACCGGA
AACTGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAACAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATCAACAATGCCGTACAGAAAGGAACTGCCCACGATGTGTTT
GAGCCGAAACCGGACCGGGAGGTCATGAATGCAGAGCGGCTGTTCAGTACGGCGCGGGAGCTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTATTGC
TCCGGGACGTAAATATCCGCAACCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAAGTCCGCCGGT
ATCTGGCTGAACCCGCTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGTCGGGTAA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAAAGCCTGCTGGCTGATAA
TATGCAGGATGGCGTCCGGATTGCCCGTGATAATCCTGACAGTGGTGTGGTGGTAAGAATCGCCGGTGAA
GGCCGTCCGTGGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATCCCGGACAACAGCGTCC
AGCCGGGAGCCGGAAATGGCGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGTCGCGCAGATGAAATTGTCAGAAAAATGGCAGAGAACAAACCTGACCTGCCG
GACGGCAAAACAGAGCTGGCTGTCAGGGATATTGCCGGGCAGGAACGTGACCGGACTGCCACTTCTGAAC
GGGAAACCGCACTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCGGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACCTGCAGAAAGAG
AAAACCCCGGGCGGAGACTGA
 Primer design