SecReT4
Protein ID: 188574227
T4SS name [ID]Tra_F [93]
Gene symbol-
Locus tagEc53638_A0010
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]70833..73679 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDB2U6G4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.2e-120, Aligned region: 3..457
Protein Sequence: 948 a.a.     [Download]
>gi|188574227|ref|YP_001919436.1| protein TraG [Escherichia coli 53638]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVQVHRVDNVPVGLAMPLSLTTRIGHAMVVSYEMIFTQPDSVTYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASSDPYTIIFSQPSPLRQVPNNNYSFLHS
SEPFVSCKDASVGLKDKLNFDTNTGGKTWHYYVQQIFGGRPDPDLLFRELLSDSYSYFYGASQSASQIMR
KNVTINALKEGITSNAARNGDTASLVSLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTGIAIGIFPLL
ILAAVFNKLTLSVLKGYVFALMWLQTWPLLYAILNSAMTFYAKQNGAPVVLSELSQIQLKYSDLASTAGY
LSAMIPPLSWMMVKGLGAGFSSVYSHFASSSISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSF
GQMTYQTGSGATTTQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAQEASNRAESALHGFSSSIAS
AWNTLSQFGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSATASAGL
YGDAHAGLDAKPSLFGVRVDVGAKVGGRASIDGSDLDSHEASSGSRASHDARHDIDAKASKDFKEASDYF
TSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTCSHEYAEMASRTESMSGQMSEDLSQQFA
QYVMKRAPQDAEAILTNTSSPEIAEHRRAMAWTFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDI
IADHQGHQAIIEQRTQDSNIRNDVKHQVDNMVTEYRGNIGDTQSSIRGEENIVRGQYSELQNHHKTEALS
QNNKYNEERESQKIIPEPSEEAVKKMVDDKKDRLKGPL
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|188574176|ref|NC_010720.1|:70833-73679 Escherichia coli 53638 plasmid p53638_75, complete sequence
GTGAATGAAGTCTATGTTATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCTTTTA
TGGGGACCCGGACATGGGATTCCATCGAAAAAATTGCGCTCACATTATCTGTTCTCGCGGTGGCTGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCTGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCCAGGTTCACCGGGTGGACAATG
TGCCGGTCGGACTGGCGATGCCACTTTCACTGACGACACGTATCGGGCATGCAATGGTGGTCAGCTACGA
AATGATATTCACCCAACCGGACAGCGTCACCTACAGCAAAACGGGGATGCTGTTCGGGGCGAATCTGATT
GTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAAATCATCAATCTGTTCCAGGACTACGTCCAGAACT
GCGTGCTGGGGGATATTTACCTGAACCACAAATACACGCTGGAAGACCTGATGGCCTCCTCTGACCCATA
CACCATAATCTTTTCTCAGCCCAGCCCTTTACGTCAGGTGCCGAATAATAATTACAGTTTTCTGCACAGC
TCAGAGCCGTTTGTGTCCTGTAAGGACGCATCCGTCGGACTGAAGGATAAGCTGAATTTTGATACGAATA
CCGGAGGCAAGACCTGGCATTATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCTGACCTGTTATT
CCGGGAACTGCTCAGTGACAGCTACAGTTATTTCTACGGTGCCAGCCAGTCGGCCAGCCAGATTATGCGT
AAGAATGTGACAATTAACGCACTGAAAGAAGGTATTACCAGTAATGCTGCCCGCAATGGTGACACCGCCA
GCCTGGTCAGTCTGGCCACTACCTCATCGATGGAGAAACAGCGTCTGGCACATGTCTCCATTGGTCATGT
AACTATGCGAAACCTGCCGATGGTCCAGACTATCCTGACGGGGATTGCCATTGGTATATTCCCGCTCCTG
ATACTGGCGGCTGTCTTTAACAAGCTGACATTGTCTGTATTAAAGGGGTATGTGTTTGCCCTGATGTGGC
TGCAGACCTGGCCGTTGTTGTATGCCATTCTGAACAGTGCCATGACATTCTATGCGAAACAGAATGGTGC
GCCGGTCGTGTTGTCTGAACTCTCTCAGATACAGCTGAAATACTCTGACCTGGCCTCCACTGCCGGGTAT
CTTTCAGCCATGATCCCCCCGTTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGT
ACAGTCACTTTGCCTCTTCCTCCATCAGCCCGACTGCCAGTGCCGCAGGCAGTGTGGTGGATGGTAATTA
CTCCTACGGCAACATGCAGACGGAGAACGTGAATGGCTTCAGCTGGAGCACCAACAGCACCACGTCATTT
GGCCAGATGACGTATCAGACCGGCAGTGGTGCAACCACCACACAGACCCGTGACGGTAATATGGTGATGG
ATGCGAGCGGGGCGATGTCCCGGTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCAGCAGCGCAACA
GGAAATGGCCCAGGAGGCGTCGAACAGAGCCGAAAGCGCCCTGCATGGTTTCAGCAGCAGTATTGCCAGT
GCCTGGAACACGCTCAGTCAGTTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACCGGTGGTGCTGACA
GCACGATGAGCGCACAGGATTCCATGATGGCCAGCCGTATGCGCAGTGCGGTGGAAAGCTATGCGAAGGC
GCATAATATCAGTAATGAGCAGGCGACAAGAGAACTGGCATCGAGAAGCGCGACTGCATCAGCTGGGTTG
TATGGTGATGCTCATGCCGGATTAGATGCAAAGCCCAGCCTTTTTGGTGTGCGTGTTGATGTTGGCGCTA
AGGTTGGTGGGCGAGCCAGCATTGACGGTAGTGATCTTGACTCACATGAAGCCAGCAGTGGTTCACGGGC
CAGCCATGATGCACGTCATGATATCGATGCTAAAGCCAGTAAGGACTTTAAAGAGGCCAGCGATTACTTT
ACCAGTCGCAAGGTCAGTGAGTCCGGCAGCCATACTGACAATAATGCTGATTCCCGGGTGGACCAGTTGT
CTGCAGCCCTGAACTCAGCGAAACAGAGTTACGACCAGTACACGACGAATATGACCTGCAGCCATGAATA
TGCGGAAATGGCCTCCCGTACTGAAAGCATGAGCGGGCAGATGAGTGAAGACCTGTCGCAACAGTTTGCA
CAGTATGTGATGAAACGCGCACCGCAGGATGCAGAAGCTATTCTGACAAATACCAGCTCACCGGAGATTG
CAGAACACCGGCGGGCGATGGCCTGGACTTTTGTTCAGGAACAGGTGCAGCCTGGTGTTGATAATGCCTG
GCGTGAATCCCGTGGGGACATCGGTAAAGGAATGGAGAGCGTACCTTCGGGCGGCGGCAGCCAGGATATT
ATTGCTGACCATCAGGGACATCAGGCCATTATTGAGCAAAGAACGCAGGACAGTAATATCCGTAATGATG
TAAAACATCAGGTTGATAATATGGTCACAGAATATCGGGGCAATATCGGAGATACTCAGAGCAGTATCCG
TGGCGAGGAAAATATTGTAAGAGGGCAGTATTCTGAACTGCAAAATCATCATAAAACAGAGGCATTATCT
CAGAATAATAAATATAATGAAGAGCGAGAAAGTCAAAAGATAATACCTGAGCCATCAGAAGAGGCTGTGA
AAAAAATGGTTGATGATAAAAAGGATAGACTGAAGGGGCCATTATGA
 Primer design