SecReT4
Protein ID: 188574232
T4SS name [ID]Tra_F [93]
Gene symboltraE
Locus tagEc53638_A0092
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]54903..55469 [+]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDB2U5R8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.6e-74, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|188574232|ref|YP_001919415.1| type IV secretion-like conjugative transfer system protein TraE [Escherichia coli 53638]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMAFNAPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|188574176|ref|NC_010720.1|:54903-55469 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACGCCAATGGCATTTAATGCCCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGTGGTGTGCTTAAAACCTGGATAGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design