SecReT4
Protein ID: 188574233
T4SS name [ID]Tra_F [93]
Gene symbol-
Locus tagEc53638_A0089
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]53930..54157 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDB2U6E0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 6e-21, Aligned region: 14..59
Protein Sequence: 75 a.a.     [Download]
>gi|188574233|ref|YP_001919412.1| conserved domain protein [Escherichia coli 53638]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLSRFPDFYNLDAIKEGTGETDS
IIKDL
 
Nucleotide Sequence: 228 bp     [Download]
>gi|188574176|ref|NC_010720.1|:53930-54157 Escherichia coli 53638 plasmid p53638_75, complete sequence
TTGAGCAGAAATATAATAAGGCCTGCTCCGGGCAATAAAGTTTTACTGGTATTGGACGATGCTACTAATC
ACAAGCTCTTAGGTGCCCGGGAGCGTAGCGGGAGAACAAAAACTAATGAGGTGCTAGTCAGGTTACGTGA
TCATCTGAGCCGTTTTCCTGACTTTTATAATCTGGATGCAATAAAGGAGGGAACAGGGGAAACTGATTCG
ATAATTAAAGATCTTTAA
 Primer design