SecReT4
Protein ID: 188574237
T4SS name [ID]Tra_F [93]
Gene symboltraA
Locus tagEc53638_A0090
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]54190..54555 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDB2U6E1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.7e-53, Aligned region: 1..119
Protein Sequence: 121 a.a.     [Download]
>gi|188574237|ref|YP_001919413.1| type IV conjugative transfer system pilin TraA [Escherichia coli 53638]
MNAILSVQGASAPVKKKSFFSKFTRLNMLRLVRAVIPVAVLMMLFPELAMASAGKGTDLMAKGQETVKAT
FGKDSSIVTWVILAEVLVGAVMYMMTKNVKFLAGFAILSVFIAVGMSVAGF
 
Nucleotide Sequence: 366 bp     [Download]
>gi|188574176|ref|NC_010720.1|:54190-54555 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAATGCTATTTTGAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGTTCGTGCAGTGATCCCGGTTGCTGTTTTGATGATGTTGTTCCCTGA
GTTAGCTATGGCTTCTGCTGGTAAAGGCACGGACCTGATGGCTAAAGGTCAGGAAACGGTTAAAGCAACT
TTCGGTAAGGACTCCAGTATTGTTACATGGGTTATCCTGGCTGAAGTGCTGGTCGGTGCAGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTGGCCGGCTTTGCCATACTCTCTGTATTTATTGCTGTGGGTATGTC
TGTTGCCGGATTCTGA
 Primer design