SecReT4
Protein ID: 188574239
T4SS name [ID]Tra_F [93]
Gene symbol-
Locus tagEc53638_A0086
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]51620..52210 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDB2U6D7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|188574239|ref|YP_001919409.1| transglycosylase SLT domain protein [Escherichia coli 53638]
MVRTTNLLSLFVEWVKLFTDKVTRGGKMKKWMLAICLMFINEICQATDCFDLAGRDYKIDPDLLRAISWK
ESRYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEA
VGAYNAGFRKTERQNQRRLAYASEVYRIYTGIKSSKGIRIPVTKKSLPEINSVQNN
 
Nucleotide Sequence: 591 bp     [Download]
>gi|188574176|ref|NC_010720.1|:c52210-51620 Escherichia coli 53638 plasmid p53638_75, complete sequence
GTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCA
GAGGTGGAAAAATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGATCTGCCAGGCCAC
TGATTGCTTTGATCTTGCAGGCCGGGATTACAAAATAGATCCTGATTTACTGAGAGCAATATCATGGAAA
GAATCCCGTTACCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGG
TAGATTCCCAGCATTTTAACGAACTGGCCCGCTATGGAATTAAGCCGGAACATCTGACAACAGATCCCTG
CATGAACATTTATACCGGTGCTTATTATCTGGCAATAGCCTTTAAAAAATGGGGCGTCTCCTGGGAGGCC
GTTGGTGCATACAATGCCGGATTCAGGAAGACCGAACGCCAGAACCAGAGACGTCTTGCCTACGCATCAG
AGGTTTACCGGATTTATACCGGGATAAAAAGCAGTAAAGGTATCCGGATTCCGGTCACGAAGAAATCACT
TCCGGAAATTAACAGCGTGCAGAACAATTAA
 Primer design