SecReT4
Protein ID: 188574240
T4SS name [ID]Tra_F [93]
Gene symboltraX
Locus tagEc53638_A0017
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]8370..9116 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB2U5N7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 1.2e-51, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|188574240|ref|YP_001919350.1| type IV secretion-like conjugative transfer system pilin acetylase TraX [Escherichia coli 53638]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSNRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVLCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|188574176|ref|NC_010720.1|:8370-9116 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CATTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTT
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCAGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATACTCCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGTATTGCCGGGTTGCTGATGC
TGGCAGTCAGCAACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTTGTGTGCCGGAAAATCATTACCCCGTTTCTGGCCCGGAGACTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design