SecReT4
Protein ID: 188574242
T4SS name [ID]Tra_F [93]
Gene symboltrbC
Locus tagEc53638_A0104
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]64398..65048 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDB2U6F5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5e-28, Aligned region: 97..195
Protein Sequence: 216 a.a.     [Download]
>gi|188574242|ref|YP_001919427.1| type IV secretion-like conjugative transfer system pilus assembly protein TrbC [Escherichia coli 53638]
MRNIMNRKIFALFALTAGMHLAVHASENVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQ
RSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAV
LSLVKDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAG
KGDSGK
 
Nucleotide Sequence: 651 bp     [Download]
>gi|188574176|ref|NC_010720.1|:64398-65048 Escherichia coli 53638 plasmid p53638_75, complete sequence
GTGAGAAATATCATGAACCGGAAAATATTTGCACTTTTTGCTCTGACAGCAGGGATGCATCTTGCTGTTC
ATGCTTCAGAAAATGTGAACACACCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACA
ACTGCGTGAAAAACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAACAGGTGCTGGAAAACCCCCTTCAG
CGTTCAGATAACCATTTTCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGC
AGGGTGCCCTGTATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGGATGCTGGGCGAAACCCG
GCACTACGGTATTCCGGCTACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCTGTG
TTGTCCCTGGTGAAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCA
TTCGCAGTGTACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGT
CGGCCAGGCGCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGG
AAAGGAGATTCCGGGAAATGA
 Primer design