SecReT4
Protein ID: 188574243
T4SS name [ID]Tra_F [93]
Gene symbol-
Locus tagEc53638_A0112
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]69460..70836 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDB2U5P7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.4e-119, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|188574243|ref|YP_001919435.1| traH protein [Escherichia coli 53638]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDYLQKL
ASDINSMNLSSCQVAQGLVGGLFPQTQESQRKVCQDIGSESNIFADWAASRQGCTVGGQSSSVRDKASDK
DKERVLKNQNIIWEALKKNRMFDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGGTAK
IYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTSIQNKAVSDTPLDDREKGFISSTTIPVFKYLIDP
QMLGVSNSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYPQAVMDNVLENLNQAQQQIAVFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGGTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|188574176|ref|NC_010720.1|:69460-70836 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCTGCTTTACTGACGGTCACACCCGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACACAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGTTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTCAAAAAT
GTTCAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATCTCGGCT
CGTTCAGTTTTATTAATGGCGAGCAGCTGCAGCGTTTTGTTAAGCAGATTATGAGCAACGCTGCCGGTTA
CTTTTTTGACCTTGCCCTGCAGACGACGGTGCCGGAAATCAAAACCGCAAAAGATTATCTGCAGAAGCTG
GCAAGCGACATTAACAGCATGAACCTCAGCTCCTGTCAGGTGGCTCAGGGGCTTGTGGGTGGCCTGTTCC
CTCAGACACAGGAATCTCAGCGGAAAGTCTGCCAGGACATTGGCAGTGAAAGCAATATCTTCGCCGACTG
GGCCGCTTCGCGTCAGGGGTGCACTGTCGGAGGACAGTCCTCCTCTGTTCGTGACAAGGCCAGTGATAAG
GATAAGGAACGGGTGCTGAAAAACCAGAATATCATATGGGAGGCACTGAAAAAGAACAGGATGTTTGACG
GCAACAAAGAGCTGAAAGAATTCATCATGACGCTCACCGGTACGCTCATTTTTGGGGAAGACAGTGAGAT
TACCCCCCTGCCGGCGCGTACTACTGACCGCGATATCCTCCGGGCAATTATGGAGGGGGGAACGGCAAAA
ATTTACCACTGTAACGATTCGGACAAGTGTCTGAAGGTGGTGGCGGATGCAAATGTGACCATCGCCCGGG
ATAAAGCCCTGAAATCACAGATTACAAAACTGCTCACCAGTATTCAGAATAAAGCGGTCAGCGACACGCC
TCTGGATGACAGGGAAAAAGGCTTCATTTCCAGCACCACCATCCCCGTCTTTAAATATCTGATTGACCCG
CAGATGCTCGGTGTGTCCAACAGCGTGGTTTACCAGCTGACGGACTATATCGGCTACGACATCATGCTCC
AGTACATTCAGGAACTGCTTCAGCAGGCCCGGGCCATGATTGCCACCGGGAATTATCCGCAGGCTGTGAT
GGACAATGTTCTGGAGAATCTGAATCAGGCACAGCAACAGATTGCTGTCTTCCAGAGTCAGGTACAGGTC
CAGCAGGATGCACTGCTGGTCGTTGACCGTCAGATGAGTTACATGCGCCAGCAGTTGTCCGCCCGCATGC
TCAGCCGTTACCAGAACAATTATCACTTCGGGGGAGGCACGCTGTGA
 Primer design