SecReT4
Protein ID: 188574248
T4SS name [ID]Tra_F [93]
Gene symboltraL
Locus tagEc53638_A0091
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]54570..54881 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB2U6E2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|188574248|ref|YP_001919414.1| type IV secretion-like conjugative transfer system protein TraL [Escherichia coli 53638]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAVICIGWGMMTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|188574176|ref|NC_010720.1|:54570-54881 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTTCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGTCTGCCACTTGACGAACTCATTCCTGCAGTAATCTGTATCGGCTGGGGAATGATGACTTCAAAATA
TCTGTTTGGCATCGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAGGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design