SecReT4
Protein ID: 188574249
T4SS name [ID]Tra_F [93]
Gene symboltraV
Locus tagEc53638_A0097
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]58399..58914 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDB2U6E8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.6e-39, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|188574249|ref|YP_001919420.1| type IV secretion-like conjugative transfer system protein TraV [Escherichia coli 53638]
MKKISLFVPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLEQPADAKPAAASLPRLADGNF
RTTSVQAVAATTPSRSRPAVTALPEQKLLAPRPLFTAAREVKTIVPVSSVAPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|188574176|ref|NC_010720.1|:58399-58914 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAAAAAGATTTCTTTATTTGTTCCTCTGCTGGGAACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAGCTGGAACAGCCTGCAGATGCAAAGCCGGCTGCGGCATCACTGCCGCGCCTGGCTGACGGGAACTTC
CGGACCACGTCGGTGCAGGCCGTTGCGGCGACAACGCCGTCCCGCAGCAGGCCTGCGGTGACGGCACTTC
CTGAGCAGAAACTGCTGGCACCACGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGATTGTTCCGGT
CAGTTCAGTTGCGCCGGTAACGCCTCCCCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAATCAGGATGTTTATCATCAGCCATCCAGTGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design