SecReT4
Protein ID: 188574253
T4SS name [ID]Tra_F [93]
Gene symboltraB
Locus tagEc53638_A0094
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]56184..57611 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDB2U6E5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 9.9e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|188574253|ref|YP_001919417.1| type IV secretion-like conjugative transfer system protein TraB [Escherichia coli 53638]
MASINTIVKRKQYLWLGIVVVGAASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRSDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQTPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|188574176|ref|NC_010720.1|:56184-57611 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTGCAG
CCTCCGCGATTGGTGGTGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACAGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAACTGGATG
TCCTGAACAAACAGCGCAGTGATGACCAGCGTCGTATTGAAAAGCTGGGACAGGACAATGCAGCCCTGGC
AGAGCAGGTGAAAGCCCTGGGTGCAAATCCTGTCACCGCGACCGGTGAGCCAGTACCGCAGACGCCAGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACACCCGTATCTTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGTAATGGTGTCACACCACCACCGCAGGTGACGTACCA
GTCTGTGCCGGTACCGAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCG
CTGCCGTACATTCCGTCAGGAAGTTTTGCTAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGTCTGGAAGCCTGGGGAGATGTCTCCAGTGAACGTGCCATT
GTACGCACCCGCAATATCAGCTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGCAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGTAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGTGCCTCCCAGCCGGCTGTCGGGCTGGGG
GCCACTGCCGCTTACGGGGCCGGTGATGTCCTGAAAATGGGTATTGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCTGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAACGCACG
CAGAGCAGAGCGGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCGGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGGGGCAACGATGGCAAATAA
 Primer design