SecReT4
Protein ID: 188574259
T4SS name [ID]Tra_F [93]
Gene symboltraK
Locus tagEc53638_A0093
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]55456..56184 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDB2U6E4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.4e-70, Aligned region: 13..235
Protein Sequence: 242 a.a.     [Download]
>gi|188574259|ref|YP_001919416.1| type IV secretion-like conjugative transfer system secretin TraK [Escherichia coli 53638]
MRKNNTAVIFGGLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFTVENKTLSALNIRESDFWQ
PGTRAVMFSQPAGQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|188574176|ref|NC_010720.1|:55456-56184 Escherichia coli 53638 plasmid p53638_75, complete sequence
ATGAGAAAAAATAATACGGCAGTAATATTCGGCGGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCTCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTTGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGCGCGTGGGAAACGTCCACACCTTACGAATCCCTG
CTTGTAACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCTGGTATCAGGTCCCGGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTACCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGATTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCGGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design