SecReT4
Protein ID: 188574264
T4SS name [ID]Tra_F [93]
Gene symboltraM
Locus tagEc53638_A0087
StrainEscherichia coli 53638 plasmid p53638_75 (NC_010720)
Repliconplasmid p53638_75 [GenBank: NC_010720] [Browse all T4SS(s) in this replicon]
Location [Strand]52506..52928 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDB2U6D8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1.2e-57, Aligned region: 14..140
Protein Sequence: 140 a.a.     [Download]
>gi|188574264|ref|YP_001919410.1| type IV secretion-like conjugative transfer system protein TraM [Escherichia coli 53638]
MKSSLLNDERFYLMARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERK
ESAFNQTEFNKLLLECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSYEMERFFPKNDEE
 
Nucleotide Sequence: 423 bp     [Download]
>gi|188574176|ref|NC_010720.1|:52506-52928 Escherichia coli 53638 plasmid p53638_75, complete sequence
GTGAAAAGTTCATTGCTTAATGATGAAAGGTTTTATCTTATGGCCAGAGTAATTTTGTATATCAGTAATG
ATGTCTATGATAAAGTAAATGCGATAGTTGAACAGCGTCGTCAGGAGGGGGCAAGAGATAAAGATATAAG
TGTTTCGGGAACAGCTTCAATGCTTCTTGAACTGGGGCTTCGCGTATATGAGGCTCAGATGGAGCGTAAA
GAGTCTGCATTTAATCAGACTGAGTTTAATAAATTACTTCTTGAATGTGTTGTAAAAACACAGTCATCAG
TAGCGAAAATTTTGGGTATTGAGTCTCTAAGTCCCCATGTCTCCGGGAATCCAAAGTTTGAATATGCCAA
TATGGTTGAAGATATTCGTGAGAAGGTGTCATATGAGATGGAACGATTTTTTCCAAAAAATGATGAGGAA
TAA
 Primer design