SecReT4
Protein ID: 188582325
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3080
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3304567..3305112 [+]
Productconjugal transfer protein
Component typeTraF
UniProt IDB1ZGK1
KEGG IDmpo:Mpop_3080
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.6e-50, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|188582325|ref|YP_001925770.1| conjugal transfer protein [Methylobacterium populi BJ001]
MTRRGYVIATCLAVMGTTLASLVPVPLRLIWNASASVPIGFYDLDPPGHLEVGDLVAVLPDKPLADFLVE
RGYIGRDVPLMKRVMGLAGQRVCRIGNAITVDAIPLGRALDRDRRGRPLPVWQGCRRLADGQIFLMNPDV
SDSLDGRYFGPIPARGVIGKATPLYTDEGGDGRFVWRAATR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3304567-3305112 Methylobacterium populi BJ001 chromosome, complete genome
ATGACCCGCCGCGGCTATGTCATCGCGACGTGTCTCGCCGTCATGGGGACGACACTGGCGTCGCTCGTTC
CGGTTCCGCTTCGCCTGATCTGGAACGCTTCGGCCAGCGTGCCGATCGGCTTCTATGACCTCGATCCTCC
GGGTCATCTGGAGGTCGGAGATCTGGTTGCGGTATTGCCGGACAAGCCGCTCGCCGATTTCCTGGTCGAG
CGCGGCTATATCGGTCGCGACGTGCCGCTGATGAAGCGCGTTATGGGGCTTGCCGGCCAGCGGGTCTGCC
GCATCGGCAACGCCATCACGGTCGACGCGATACCGCTTGGGCGTGCGCTCGACCGCGACCGGCGCGGACG
TCCGCTGCCGGTCTGGCAGGGCTGTCGCCGCCTCGCCGACGGTCAGATTTTCCTCATGAACCCCGATGTC
AGCGACAGCCTGGACGGCCGTTACTTCGGTCCGATCCCGGCGCGCGGCGTCATCGGCAAGGCGACGCCGC
TCTACACCGACGAGGGTGGCGATGGCCGCTTCGTCTGGCGTGCCGCCACACGCTGA
 Primer design