SecReT4
Protein ID: 188582327
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3082
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3305531..3306304 [+]
Productlytic transglycosylase
Component typeTrbN
UniProt IDB1ZGK3
KEGG IDmpo:Mpop_3082
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|188582327|ref|YP_001925772.1| lytic transglycosylase [Methylobacterium populi BJ001]
MAGPRPTTSRRHVSGLRSAARRMVLLLLTGLSVASVVPAIALAQDAPIARPSVRDPQAPYIAEAAARFRI
PIAWIRAVMRAESAGDPSATSPKGAMGLMQIMPETWAGLRARHRLGADPYDPHDNIIAGAAYIRELSDRY
GSPGWIAAYNAGPGRYEDSLDGRPLPAETRAYLAIIAPSVSSGDPASPVIVAAADPLAWTRAPLFVAQSE
RSAAADPLPVERASSDASATPAVRDVSAIVPQSGGLFVARADDRTAR
 
Nucleotide Sequence: 774 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3305531-3306304 Methylobacterium populi BJ001 chromosome, complete genome
ATGGCTGGACCTCGTCCGACGACGAGCCGCCGGCATGTGTCCGGGCTGCGCTCCGCAGCTCGGCGCATGG
TTCTCCTTCTCCTTACCGGCCTCTCTGTCGCAAGCGTCGTACCGGCGATCGCTCTGGCTCAGGATGCGCC
GATCGCACGACCATCGGTCCGCGATCCCCAAGCTCCATATATCGCTGAAGCGGCGGCGCGCTTCCGAATA
CCGATTGCGTGGATACGCGCTGTCATGCGGGCGGAAAGCGCCGGCGATCCCAGCGCGACCTCACCCAAAG
GGGCGATGGGCCTGATGCAGATCATGCCCGAGACCTGGGCGGGCCTGCGTGCTCGCCATCGCCTCGGCGC
CGATCCTTACGATCCCCACGACAACATCATCGCGGGCGCGGCCTATATTCGCGAGCTGTCCGACCGGTAC
GGTTCGCCCGGCTGGATCGCGGCCTACAATGCTGGCCCCGGCCGTTACGAGGACTCTCTCGACGGCCGCC
CGCTGCCCGCAGAAACGCGCGCCTATCTCGCCATCATCGCGCCGTCGGTCAGCAGTGGCGATCCGGCCAG
CCCCGTCATCGTCGCGGCGGCCGATCCGCTCGCCTGGACGCGCGCACCACTGTTCGTCGCGCAATCGGAG
CGCAGCGCCGCTGCCGATCCTTTGCCGGTTGAACGCGCCTCCAGTGACGCGAGCGCGACGCCGGCCGTGC
GCGATGTCTCCGCCATCGTGCCGCAGTCCGGCGGGCTTTTCGTCGCCCGCGCCGACGATCGGACCGCGCG
ATGA
 Primer design