SecReT4
Protein ID: 188582329
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3084
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3308313..3310298 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDB1ZGK5
KEGG IDmpo:Mpop_3084
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.7e-104, Aligned region: 111..556
TraG-D_C [PF12696], Evalue: 1.2e-30, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 7.9e-29, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 2e-06, Aligned region: 146..478
Protein Sequence: 661 a.a.     [Download]
>gi|188582329|ref|YP_001925774.1| conjugal transfer coupling protein TraG [Methylobacterium populi BJ001]
MSATKILWGQILTVSAIVLATTWGATEWVAWRLAFQPELGAPWFQLFGFPFYLPPAFFWWWYGFDAYAPS
IFVEGAWIAASGGFISVAVAIGMSVWRAREAKKVETYGSARWAEKEEVKAAGLLNPDGVVLGRYDHDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNPKSSAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEEEKTLAGVAAFLSDPK
RPIESTLAAMMKTAHLGEAGPHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAEVTRRCDWRI
TDIVTARHPTTLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKAGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGANNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMRNYA
GHRLSPWLGHLMVSRSETARQLLTPGEIMQLPPSDEIVMVAGTPPIRAKKARYYEDARFKERILPPPALV
VPKQGRPDDWTALPLPLRPETAEPGSAAEASDEDPTASERRQQPELNRLEPVEKKAPVENEFEIGLADEA
EDDPVRNSRMNRLMQGVARQVSLDPGDGMEL
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3308313-3310298 Methylobacterium populi BJ001 chromosome, complete genome
ATGTCCGCGACGAAAATCCTCTGGGGCCAAATCCTGACCGTCTCCGCGATCGTGCTCGCCACGACCTGGG
GCGCAACGGAATGGGTGGCCTGGCGGCTCGCCTTCCAGCCGGAGCTTGGGGCACCGTGGTTCCAGCTGTT
CGGTTTTCCCTTCTATTTGCCGCCCGCCTTCTTCTGGTGGTGGTATGGCTTTGATGCCTATGCGCCGTCG
ATCTTCGTCGAGGGCGCGTGGATCGCGGCGTCAGGCGGATTCATCTCGGTGGCCGTCGCCATCGGCATGT
CGGTCTGGCGCGCCCGCGAGGCCAAGAAGGTCGAGACCTACGGCTCCGCTCGCTGGGCCGAGAAGGAAGA
AGTGAAGGCGGCGGGACTTCTCAATCCCGATGGCGTCGTGCTCGGCCGCTACGACCATGATTATCTTCGC
CATGATGGACCGGAGCATGTGCTGTGCTTCGCGCCGACCCGTTCAGGCAAGGGCGTTGGCCTGGTCGTCC
CCTCGCTGCTGACCTGGCCTGGGTCGGCGATCGTCCACGACATCAAGGGCGAGAACTGGCAACTCACCGC
CGGCTTTCGCGCACGACATGGCCGCGTGCTCCTGTTCGATCCGACCAACCCGAAGTCCTCGGCCTACAAT
CCGCTGCTGGAGGTCCGCCGCGGCGAATGGGAGGTGCGCGACGTCCAGAACATCGCGGACATCCTCGTCG
ATCCCGAAGGCTCGCTCGAGAAGCGCAACCATTGGGAAAAAACCAGCCACGCGCTGCTGGTCGGTGCAAT
CCTCCATGTCCTCTACGCTGAAGAGGAAAAGACTCTCGCTGGCGTCGCTGCCTTCCTCTCCGATCCGAAG
CGGCCGATCGAGTCGACGCTCGCCGCGATGATGAAGACGGCGCATCTCGGTGAAGCCGGGCCGCACCCCG
TCATCGCCAGCGCCGCGCGCGAGCTGCTCAACAAATCCGACAACGAGCGATCGGGCGTGCTGTCGACCGC
CATGTCCTTCCTCGGCCTCTATCGCGATCCTGTCGTGGCAGAGGTGACGCGCCGCTGCGACTGGCGGATC
ACCGACATCGTGACGGCTAGGCATCCGACCACGCTCTACCTCGTCGTCCCGCCGTCCGACATCAACCGCA
CCAAGCCGCTCATCCGCCTGATCCTCAATCAGGTCGGCCGCCGCCTGACCGAGGATCTCCAGGCCAAGGC
CGGTCGCCATCGGCTGCTGCTGATGCTCGACGAATTTCCGGCGCTGGGCCGGCTCGATTTCTTCGAGTCC
GCGCTGGCCTTCATGGCGGGCTATGGCCTGAAGAGTTTCCTGATCGCGCAAAGCCTCAATCAGATCGAGA
AAGCCTATGGCGCGAACAACTCGATCCTCGACAACTGCCATGTGCGGGTGAGCTTCGCGACCAACGACGA
GCGCACGGCCAAGCGCGTATCGGACGCGCTCGGCACCGCGACCGAGATGAAGGCGATGCGAAACTATGCG
GGGCACCGGCTGTCGCCGTGGCTCGGACATCTGATGGTGTCGCGCTCAGAAACGGCCCGCCAGCTGCTCA
CCCCCGGCGAGATCATGCAGCTTCCGCCGAGCGATGAGATCGTCATGGTCGCGGGCACGCCGCCGATCCG
GGCGAAAAAGGCCCGCTACTACGAGGACGCGCGTTTCAAGGAGCGCATCCTGCCGCCGCCAGCACTGGTC
GTCCCGAAACAGGGGCGTCCCGACGATTGGACCGCGCTGCCGCTCCCACTTCGACCTGAGACGGCAGAGC
CGGGATCAGCGGCGGAGGCCAGCGATGAAGATCCAACCGCTTCCGAACGTCGCCAGCAACCCGAACTCAA
TCGCTTGGAGCCTGTCGAGAAGAAGGCTCCGGTCGAGAACGAGTTCGAGATCGGCCTTGCCGACGAGGCC
GAAGATGACCCGGTCCGCAACAGCCGGATGAACCGGCTGATGCAGGGCGTTGCCCGTCAGGTCTCGCTCG
ATCCGGGCGATGGCATGGAACTGTGA
 Primer design