SecReT4
Protein ID: 188582331
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3086
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3310926..3311957 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDB1ZGK7
KEGG IDmpo:Mpop_3086
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.8e-86, Aligned region: 25..290
Protein Sequence: 343 a.a.     [Download]
>gi|188582331|ref|YP_001925776.1| P-type conjugative transfer ATPase TrbB [Methylobacterium populi BJ001]
MAGSHHNPEGLARGARMLRTALGAAIARFLEDASVVEVMLNPDGRIWIDRLSEGLADTGEMLSAADGERI
VRLVAHHVGAEVHAGSPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAVAVFTLDDYVHAGIMSARQAE
ALRQGIIARDNILVAGGTSTGKTTLTNALLAEVAKTSDRVVIIEDTRELQCAAPNLVAMRTQDGVASLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGVGTIHAGSAIGALRRMEQLIQEAVVTVPRALIA
ETIDLVAVLSGRGSARRLSELVRVEGLGPDADYRVAPAVSSSSAGGDRCAGSLNPTSIEGEPL
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3310926-3311957 Methylobacterium populi BJ001 chromosome, complete genome
ATGGCCGGTTCACATCACAATCCAGAGGGCTTGGCGCGCGGCGCGCGGATGCTGCGCACAGCGCTCGGCG
CCGCCATCGCCCGGTTTCTGGAAGACGCCTCCGTCGTCGAGGTCATGCTGAACCCGGACGGGCGCATCTG
GATCGACCGACTCTCCGAAGGGCTGGCCGATACGGGCGAGATGCTGTCCGCCGCCGATGGCGAACGCATC
GTGCGTCTGGTCGCGCACCATGTCGGCGCCGAGGTCCATGCCGGTAGTCCGCGCGTCTCTGCCGAGCTGC
CCGAAACGGGCGAGCGGTTCGAGGGTCTGCTGCCACCGGTCGTTGCAGCGCCGGCCTTCGCCATCCGCAA
ACCTGCCGTCGCCGTCTTTACCCTCGACGACTACGTCCACGCGGGGATCATGTCGGCGCGACAGGCCGAG
GCGCTCCGTCAGGGCATCATCGCCCGGGACAATATCCTCGTCGCCGGCGGCACCTCGACCGGCAAGACCA
CACTCACCAATGCGCTGCTCGCGGAAGTCGCGAAGACGTCCGATCGCGTCGTCATCATCGAGGACACCCG
CGAGCTACAATGCGCGGCACCCAATCTCGTCGCCATGCGGACCCAGGACGGTGTGGCGTCGTTGTCGGAT
CTCGTCCGCTCTTCGCTACGCCTGCGCCCCGACCGCATCCCGATTGGTGAGGTCCGTGGCGCCGAGGCCC
TCGACCTCCTGAAAGCATGGGGGACTGGCCATCCAGGCGGCGTCGGCACGATCCACGCTGGCAGCGCCAT
CGGCGCGTTGCGGCGCATGGAACAGCTCATCCAGGAAGCCGTCGTTACCGTTCCGCGCGCCCTGATCGCC
GAGACGATCGACCTCGTGGCCGTCCTTTCTGGCCGCGGTTCCGCGCGCCGCCTCTCCGAACTCGTCCGTG
TCGAGGGCCTCGGCCCTGACGCCGATTACCGCGTCGCGCCCGCCGTCAGCTCTTCGTCTGCCGGGGGCGA
CCGCTGCGCGGGCTCTCTCAACCCCACCAGCATCGAAGGAGAACCCCTGTGA
 Primer design