SecReT4
Protein ID: 188582332
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3087
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3311954..3312286 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB1ZGK8
KEGG IDmpo:Mpop_3087
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.3e-26, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|188582332|ref|YP_001925777.1| conjugal transfer protein Trbc [Methylobacterium populi BJ001]
MIQRLHQARHHLVTALSVAALSVVMAAPAHASGSSMPWEAPLQSILQSIEGPVAKIVAVIIIITTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3311954-3312286 Methylobacterium populi BJ001 chromosome, complete genome
GTGATTCAACGCCTGCACCAGGCCCGCCATCACCTCGTCACGGCTCTGTCCGTGGCCGCGCTTTCCGTGG
TGATGGCCGCGCCGGCCCATGCCTCCGGCTCGTCCATGCCGTGGGAGGCGCCGCTGCAATCCATCCTTCA
GTCGATCGAAGGCCCCGTCGCCAAGATCGTCGCCGTCATCATCATTATCACCACCGGCCTGACGCTGGCT
TTCGGCGACACGTCGGGCGGCTTCCGCCGGCTGATCCAGATCGTGTTCGGTCTGTCGATCGCCTTTGCCG
CATCGAGCTTCTTCCTCTCCTTCTTCTCGTTCGGCGGCGGGGCGCTGGTCTGA
 Primer design