SecReT4
Protein ID: 188582333
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3088
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3312286..3312558 [+]
Productconjugal transfer protein TrbB
Component typeTrbD
UniProt IDB1ZGK9
KEGG IDmpo:Mpop_3088
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2e-11, Aligned region: 1..81
Protein Sequence: 90 a.a.     [Download]
>gi|188582333|ref|YP_001925778.1| conjugal transfer protein TrbB [Methylobacterium populi BJ001]
MADAADEVPGFTVPIHRALTEPILLGGAPRAIAIMNGTLAGAVGLGLRLWLVGLAIWAIGHFAAVWAAKR
DPLFVDVGRRHLRIPAHLTV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3312286-3312558 Methylobacterium populi BJ001 chromosome, complete genome
ATGGCGGACGCCGCCGACGAAGTGCCGGGCTTCACCGTGCCGATTCATCGGGCGCTGACCGAGCCGATCC
TGCTTGGCGGCGCACCGCGCGCCATCGCGATCATGAACGGAACACTCGCCGGCGCAGTCGGCCTCGGCTT
GCGGCTCTGGCTGGTCGGTCTTGCGATCTGGGCCATCGGCCACTTCGCGGCGGTGTGGGCGGCCAAGCGC
GATCCCCTCTTCGTCGATGTCGGCCGCCGCCATCTGCGCATCCCCGCGCACCTCACGGTCTGA
 Primer design