SecReT4
Protein ID: 188582334
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3089
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3312572..3315010 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDB1ZGL0
KEGG IDmpo:Mpop_3089
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.4e-34, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 7.3e-14, Aligned region: 182..388
Protein Sequence: 812 a.a.     [Download]
>gi|188582334|ref|YP_001925779.1| conjugal transfer ATPase TrbE [Methylobacterium populi BJ001]
MMNLAEYRDRNSRLADFLPWVALVGSGLVLNKDGSFQRTARFRGPDLDSAVAAELVAVAGRLNNAFRRLG
SGWAIFVEAQRHPSNHYPDSHFPDAASALVDAERKAGFEEAGAHFESSYFLTFTYLPPAEDAARAESWLY
EGREQRGLDPHEALGGFTDRTDRLLRLIEAFMPECRWLDDGETLTYLHGCVSTHRHRVRVPETPMYLDAL
LADQPLTGGLEPRLGQAHLRVLTVTGFPTATTPGLLDELNRLAFPYRWSTRAVLLDKTDATKLLTKIRRQ
WFAKRKSVAAILKEVMTNEASVLVDTDASNKAADADLALQELGADYAGIAYVTATVTVWDADPRVADEKL
RLVEKVIQGRDFTAMAETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFAAPP
LLFGKTEGSTPFRFSLHVGDVGHTLIVGPTGAGKSVLLALMALQFRRYADAQVFAFDFGGSIRAAALAMG
GDWHDLGGDLSDSAATSVSLQPLAHIHDVSERAWAADWIGAILTREAVAITPEVKEHIWTALTSLASAPV
EERTVTGLTVLLQSNDLKQALRSYCIGGPYGRLLDAEREHLGTATVQAFETEGLIGTGAAPAVLSYLFHR
IEDRFDGSPALLIIDEGWLALDDDGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSVIAPAIIESCQTR
LLLPNERAIEPQITAIYRRFGLNDRQIEIIARAMPKRDYYCQSRRGNRLFELGLSDVALALCAASSKTDQ
SAISRLFAEHGRAGFLAAWLRHRDVGWAADLIPTLTKTEKLP
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3312572-3315010 Methylobacterium populi BJ001 chromosome, complete genome
ATGATGAACCTCGCCGAATATCGCGACCGTAATAGCCGGCTCGCCGACTTCCTGCCCTGGGTGGCGCTGG
TCGGCTCAGGTCTCGTGCTCAACAAGGACGGCAGCTTCCAGCGCACGGCGCGCTTTCGCGGTCCCGACCT
GGATTCCGCAGTCGCGGCGGAGCTGGTCGCGGTCGCCGGCCGGCTCAACAACGCCTTCCGTCGTCTCGGC
TCAGGCTGGGCGATTTTCGTGGAAGCGCAGCGCCATCCCTCGAACCACTATCCCGACAGCCATTTTCCGG
ATGCCGCATCGGCGTTGGTCGACGCCGAGCGCAAGGCCGGTTTCGAGGAAGCTGGAGCGCATTTCGAGTC
CAGCTACTTCCTCACCTTCACCTACCTGCCGCCGGCCGAGGATGCCGCCCGTGCAGAAAGCTGGCTCTAT
GAGGGCCGTGAACAGAGGGGCCTCGATCCGCACGAGGCTCTGGGTGGCTTCACCGACCGCACCGACCGGC
TTCTGCGCCTCATCGAAGCCTTCATGCCCGAATGCCGCTGGCTCGATGACGGCGAAACGCTGACCTACCT
GCATGGATGCGTTTCGACGCACCGGCATCGCGTCCGCGTTCCCGAAACGCCGATGTATCTCGACGCGCTG
CTCGCCGATCAGCCGCTCACCGGCGGTCTGGAGCCGCGCCTTGGGCAGGCACATCTGCGCGTTCTCACCG
TCACCGGATTCCCGACCGCGACGACACCGGGCCTGCTCGACGAGCTGAACCGGCTGGCTTTCCCCTATCG
GTGGAGCACGCGCGCGGTCCTGCTCGACAAGACCGACGCGACCAAGCTGCTGACCAAGATCCGGCGCCAA
TGGTTCGCCAAGCGCAAATCGGTCGCCGCGATCCTCAAGGAGGTGATGACCAACGAAGCGTCCGTCCTTG
TCGACACGGACGCATCGAACAAGGCGGCGGACGCCGATCTCGCGCTTCAGGAGCTGGGCGCCGACTATGC
CGGCATCGCCTATGTCACGGCGACGGTGACAGTGTGGGACGCTGATCCGCGCGTTGCCGACGAGAAACTG
CGGCTGGTCGAGAAGGTCATCCAGGGCCGCGACTTCACCGCGATGGCGGAAACCATCAACGCGGTGGACG
CCTGGCTCGGCAGTCTTCCCGGGCATGTTTACGCCAATGTGCGGCAACCGCCGATCTCCACCCTCAATCT
CGCCCACATGATCCCCCTGAGCGCCGTGTGGGCGGGGCCGGAACGGGACGAGCATTTCGCAGCGCCCCCG
CTGCTGTTCGGTAAAACCGAAGGCTCGACCCCGTTCCGGTTTTCTCTTCACGTCGGCGATGTCGGCCATA
CGCTGATCGTCGGCCCGACCGGCGCGGGCAAATCCGTGCTGCTGGCGCTCATGGCGCTCCAGTTTCGCCG
CTATGCCGACGCCCAGGTGTTCGCTTTCGATTTTGGCGGTTCGATCCGGGCGGCGGCCCTCGCCATGGGC
GGTGACTGGCACGACCTCGGCGGGGATCTCAGCGACAGCGCCGCGACGAGCGTCAGTCTTCAGCCACTGG
CTCATATCCACGACGTCTCCGAGCGCGCCTGGGCCGCCGATTGGATCGGCGCCATCCTGACGCGCGAAGC
GGTCGCCATCACGCCAGAAGTGAAGGAGCACATCTGGACGGCGTTGACCTCGCTGGCCTCGGCGCCGGTC
GAGGAACGCACCGTCACCGGCCTCACCGTTCTGCTCCAGTCCAACGACCTGAAGCAGGCGCTGCGTTCCT
ATTGCATCGGCGGCCCCTATGGGCGGCTGCTCGACGCCGAACGGGAACATCTCGGCACGGCGACGGTCCA
GGCGTTCGAGACCGAAGGGCTGATCGGTACCGGCGCGGCGCCCGCGGTTCTCTCCTATCTCTTTCACCGC
ATCGAGGACCGCTTCGACGGATCGCCGGCCCTTCTCATCATCGACGAGGGGTGGCTCGCGCTGGACGACG
ACGGCTTTGCCGGTCAGCTCCGCGAATGGCTGAAGACGCTGCGTAAGAAGAACGCCAGCGTCATCTTCGC
CACGCAGAGCCTGTCGGACATCGATGGCTCAGTCATCGCGCCCGCCATCATCGAAAGCTGCCAGACCCGC
CTTCTGCTCCCGAACGAGCGCGCCATCGAACCGCAGATCACGGCGATCTACCGGCGCTTCGGCCTCAACG
ACCGCCAGATCGAGATCATCGCGCGCGCCATGCCCAAGCGCGACTATTACTGCCAATCCCGGCGCGGCAA
TCGCCTGTTCGAGCTGGGGCTGTCGGACGTCGCCCTCGCGCTCTGCGCCGCTTCCTCGAAAACCGACCAA
TCCGCGATCTCGCGGCTGTTCGCCGAGCACGGGCGGGCCGGCTTCCTCGCCGCCTGGCTCCGCCACCGCG
ACGTCGGCTGGGCGGCTGATCTCATCCCGACGCTCACCAAAACGGAGAAACTGCCATGA
 Primer design