SecReT4
Protein ID: 188582335
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3090
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3315007..3315768 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB1ZGL1
KEGG IDmpo:Mpop_3090
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.2e-08, Aligned region: 17..55
Protein Sequence: 253 a.a.     [Download]
>gi|188582335|ref|YP_001925780.1| conjugal transfer protein TrbJ [Methylobacterium populi BJ001]
MTLPRFRAARLVAALLVAPVAFAPMLATPAHAQWTVFDPSNYAQNVLAAARSLQQVTNQITSLQNEAQML
INQARNLASLPYSSLQQLQQSVQRTQQLLSQAQNIAYSVQQIDQAFQSKYANVSMSAPEQQLVADARSRW
QNTVGGLQDAMRVQAGVVGNIDTNRAQMSTLVGASQSATGALQATQAGNQLLALQAQQLADLTAVVTANG
RAQALQSAEQAAAAEQGREQRRRFLTPGAGYQPGNAQMFYGNK
 
Nucleotide Sequence: 762 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3315007-3315768 Methylobacterium populi BJ001 chromosome, complete genome
ATGACCTTGCCTCGCTTTCGCGCGGCCCGGCTCGTTGCCGCGCTGCTCGTCGCCCCCGTTGCGTTCGCCC
CGATGCTGGCGACGCCAGCCCACGCGCAATGGACCGTGTTCGACCCGTCCAACTATGCGCAAAACGTCCT
GGCGGCCGCTCGTAGCCTTCAGCAGGTCACGAACCAGATCACCTCGCTTCAGAACGAAGCGCAGATGCTC
ATCAATCAGGCTCGTAATCTGGCGAGCCTGCCTTACTCGTCACTGCAACAGCTTCAGCAGTCGGTGCAGC
GCACGCAGCAATTGCTCAGCCAGGCGCAGAACATCGCCTACAGCGTCCAGCAGATCGACCAGGCGTTCCA
GAGCAAATACGCCAATGTCTCGATGTCGGCGCCAGAGCAGCAGCTCGTCGCCGATGCGCGCTCGCGCTGG
CAGAACACCGTGGGCGGGTTGCAGGATGCCATGCGCGTCCAGGCTGGTGTCGTCGGGAATATCGACACCA
ATCGCGCCCAGATGTCGACGCTGGTCGGCGCCAGCCAGTCGGCGACCGGCGCGCTTCAGGCGACGCAGGC
CGGCAACCAGCTTCTCGCGCTCCAGGCGCAGCAACTCGCCGACCTCACCGCCGTCGTCACCGCCAACGGC
CGGGCTCAGGCTTTGCAGTCGGCGGAACAAGCCGCCGCCGCCGAACAGGGCCGCGAACAGCGTCGCCGTT
TTCTGACGCCGGGCGCGGGCTACCAGCCCGGCAACGCGCAGATGTTCTACGGAAACAAGTGA
 Primer design