SecReT4
Protein ID: 188582337
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3092
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3316153..3317505 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB1ZGL4
KEGG IDmpo:Mpop_3092
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8e-53, Aligned region: 37..262
Protein Sequence: 450 a.a.     [Download]
>gi|188582337|ref|YP_001925782.1| conjugal transfer protein TrbL [Methylobacterium populi BJ001]
MGGTGVIDHFLEVFTRYIDGGFGLLGGEVGFIATTLIVIDVTLAALFWSWGADDNIIARLVKKTLFVGIF
AYLISNWNNLARIIFESFAGLGLKASGTGFAVSDLMRPGKVAQTGLDAGRPLLDSISNLMGYWSFFENFI
QIACMFFAWALVLLAFFVLAIQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSEFTAGFGGATPSIDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAIGTGLA
AGGMVAAGAATAGAVVSGGAALAGGAAAAARGGATLAGGATSAYSLGAAGQSGASAVASGLGNVASTGAK
AAVSPLKRAAGRAADSLTQSYRTGSHAATEIATGASGATASEASAGAASPASSATDGPPAWAKRMKRSQQ
LTHGVQAAAHAVRSGDSHGGGSSVNLSGSD
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3316153-3317505 Methylobacterium populi BJ001 chromosome, complete genome
GTGGGCGGCACCGGCGTCATCGACCATTTCCTCGAGGTCTTCACCCGCTACATCGATGGCGGCTTCGGCC
TGCTCGGCGGCGAAGTCGGATTCATCGCCACAACGCTGATCGTCATCGACGTGACGCTTGCCGCGCTGTT
CTGGTCGTGGGGCGCCGATGACAACATCATCGCCAGGCTGGTCAAAAAGACGCTGTTCGTCGGCATCTTC
GCTTACCTGATCTCCAACTGGAACAATCTCGCCCGTATCATCTTCGAGAGCTTCGCCGGCCTTGGCCTGA
AAGCCTCTGGCACGGGCTTCGCGGTCAGTGATCTGATGCGGCCCGGCAAGGTCGCGCAGACCGGCCTCGA
CGCCGGCCGGCCGTTGCTCGACTCGATCTCGAACCTGATGGGCTACTGGTCCTTCTTCGAGAACTTCATC
CAGATCGCCTGCATGTTCTTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCGTCCTCGCGATCCAGCTTT
TCGTCACCCTGATCGAGTTCAAGCTGACGACACTTGCCGGCTTCGTGCTGATCCCGTTCGGCCTGTTCGG
CAAATCGGCGTTCATGGCCGAGCGGGTGCTGGGCAATGTGATTTCCAGCGGCATCAAGGTTCTCGTTCTC
GCCGTCATCATCGGCATCGGCTCGACGCTCTTCTCCGAGTTCACCGCTGGTTTTGGCGGCGCCACGCCGT
CGATCGACGACGCGATGGCGATCGTGCTCGCCGCGCTTTCTCTTCTTGGCCTCGGCATCTTCGGCCCCGG
CATCGCCAACGGCCTCGTCTCGGGTGGCCCGCAACTCGGTGCGGGCGCCGCCATCGGAACTGGCCTTGCC
GCCGGCGGCATGGTCGCGGCCGGCGCAGCGACCGCTGGCGCCGTCGTCTCCGGTGGCGCCGCCCTTGCTG
GCGGCGCGGCCGCCGCCGCCCGTGGCGGGGCGACACTCGCAGGCGGTGCGACCAGCGCCTACAGCCTTGG
TGCGGCCGGGCAATCAGGCGCGTCTGCCGTCGCCTCTGGTCTCGGCAATGTCGCCAGCACGGGCGCGAAG
GCCGCCGTCTCGCCGCTGAAGCGCGCCGCTGGTCGTGCTGCCGATAGCCTGACGCAGAGCTACCGGACCG
GCAGCCACGCCGCGACGGAGATCGCCACTGGCGCATCTGGCGCAACGGCGAGCGAAGCCTCCGCTGGAGC
CGCCTCTCCGGCATCATCCGCCACCGACGGTCCACCGGCCTGGGCGAAGCGCATGAAGCGTTCTCAGCAG
CTCACGCACGGCGTTCAGGCGGCCGCTCACGCCGTTCGCAGCGGCGACAGCCACGGCGGCGGCTCCTCCG
TCAACCTTTCCGGAAGCGACTGA
 Primer design