SecReT4
Protein ID: 188582338
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3093
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3317508..3318191 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB1ZGL5
KEGG IDmpo:Mpop_3093
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-59, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|188582338|ref|YP_001925783.1| conjugal transfer protein TrbF [Methylobacterium populi BJ001]
MFKRPATHYGKSPQPETPYQRAAQVWDDRIGSARVQARNWRFMAFGSLALSMGLSAALVWQSTNGSIVPW
VVQVDRLGQAQAVAPATADYQPNDPQIAFYLARFIEQVRSIPADAIIVRQNWLRAYDFTTQAGALALSDY
ARANDPFAKVGKQQVAVEVSSVIRASPSSFRIAWIERRYQDGALASTERWSAILTVTVQSPRDADTLRKN
PLGIYVNAINWSKELGQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3317508-3318191 Methylobacterium populi BJ001 chromosome, complete genome
ATGTTCAAACGACCAGCCACCCACTACGGCAAATCTCCACAGCCCGAGACGCCCTATCAACGCGCCGCGC
AGGTTTGGGACGACCGCATCGGCTCCGCCCGCGTGCAAGCCCGCAACTGGCGCTTCATGGCATTCGGCTC
GCTGGCTCTCTCGATGGGCCTTTCCGCCGCGCTGGTATGGCAGTCCACCAATGGCTCGATCGTGCCCTGG
GTGGTGCAGGTCGATCGGCTCGGCCAAGCCCAAGCCGTCGCGCCGGCAACCGCCGACTATCAGCCGAACG
ATCCGCAGATCGCCTTCTACCTCGCGCGCTTCATCGAGCAGGTCCGCTCGATCCCGGCCGATGCGATCAT
CGTGCGGCAGAACTGGCTGCGCGCTTACGACTTCACCACCCAGGCCGGGGCTCTGGCGCTGAGCGACTAT
GCCCGCGCCAACGATCCCTTCGCCAAGGTCGGCAAACAGCAAGTCGCGGTGGAGGTCTCGTCGGTGATTC
GCGCCTCGCCGTCGAGCTTTCGCATCGCCTGGATCGAGCGCCGCTATCAGGACGGTGCTCTCGCCTCCAC
CGAACGCTGGTCCGCCATCCTCACCGTCACCGTTCAGTCGCCGCGCGACGCCGACACGCTGAGAAAGAAC
CCGCTCGGCATCTACGTCAACGCCATCAACTGGTCGAAGGAGCTCGGACAATGA
 Primer design