SecReT4
Protein ID: 188582339
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3094
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3318188..3319255 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB1ZGL6
KEGG IDmpo:Mpop_3094
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-70, Aligned region: 124..348
Protein Sequence: 355 a.a.     [Download]
>gi|188582339|ref|YP_001925784.1| P-type conjugative transfer protein TrbG [Methylobacterium populi BJ001]
MTPALRKAAPWSAGRPAFLIHAIPVFRKAGMPLLLLGASALAGCATHTPPPEISYDNAAPAVQAADPPKP
VQVVELPKPLPLPGQLKPVGRDGKPEPEAADPTVRVNQANAAARVQPVRNGFINSMQVYPFVDGALYQVY
ASPGQITDIALQPGEQLVGSGPVAAGDTVRWIIGDTESGAGAGKQIHILVKPTRAELLTNLVINTDRRTY
HMELRSTPSTYMASVSWQYPQDQLIALRRQNSQAEAAQPVADGVDLARVNFRYDVTGDRAPWRPLRAFDD
GRQVFIEFPRGIGQGEMPPLFVVGPEGDTSELVNYRVRGNYMIVDRLFAAAELRFGAGKNQKRVRIVRTD
GRPAS
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3318188-3319255 Methylobacterium populi BJ001 chromosome, complete genome
ATGACGCCAGCACTCCGCAAAGCCGCCCCCTGGAGTGCAGGGCGTCCGGCTTTCCTCATCCACGCCATTC
CGGTTTTCCGTAAGGCCGGAATGCCGCTTCTGCTGCTCGGCGCATCGGCGCTCGCCGGGTGCGCCACGCA
TACACCGCCGCCGGAGATCTCCTACGACAATGCGGCGCCGGCCGTGCAGGCCGCCGATCCGCCTAAACCC
GTGCAGGTCGTGGAACTGCCGAAGCCATTGCCGCTTCCCGGCCAGTTGAAGCCGGTTGGCAGGGACGGCA
AACCCGAACCGGAAGCCGCCGACCCGACGGTCCGCGTCAACCAGGCCAACGCCGCCGCGCGTGTCCAGCC
CGTCCGCAATGGCTTCATCAACTCGATGCAGGTCTATCCTTTCGTCGATGGCGCGCTCTATCAGGTCTAT
GCGTCACCGGGGCAGATCACCGACATCGCCCTCCAGCCTGGTGAGCAGCTCGTCGGTTCCGGCCCAGTCG
CCGCCGGCGACACCGTGCGCTGGATCATCGGCGATACCGAGAGCGGCGCCGGCGCGGGTAAGCAGATCCA
TATTCTCGTGAAGCCAACGCGGGCCGAGTTGCTGACCAACCTCGTCATCAACACCGACCGCCGTACCTAC
CATATGGAACTGCGCTCGACGCCTTCGACCTATATGGCGTCAGTTTCCTGGCAATATCCGCAGGATCAGC
TCATCGCGCTGCGCCGCCAGAACAGTCAGGCCGAGGCTGCGCAGCCCGTTGCCGATGGCGTCGACCTCGC
GCGTGTGAACTTCCGCTACGATGTGACAGGCGACCGTGCGCCGTGGCGACCGCTGCGCGCCTTCGACGAT
GGCCGACAGGTCTTCATCGAGTTTCCGCGCGGTATCGGCCAGGGCGAGATGCCGCCGCTGTTCGTGGTCG
GTCCGGAAGGCGACACCTCGGAGCTGGTGAACTATCGGGTGCGCGGCAACTACATGATCGTGGACCGGCT
GTTCGCCGCCGCCGAACTGCGCTTCGGTGCGGGCAAAAATCAGAAGCGGGTCCGCATCGTCCGCACCGAT
GGGAGGCCGGCATCGTGA
 Primer design