SecReT4
Protein ID: 188582340
T4SS name [ID]Trb [249]
Gene symbol-
Locus tagMpop_3095
StrainMethylobacterium populi BJ001
Repliconchromosome [GenBank: NC_010725] [Browse all T4SS(s) in this replicon]
Location [Strand]3319252..3320517 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB1ZGL7
KEGG IDmpo:Mpop_3095
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-64, Aligned region: 238..416
Protein Sequence: 421 a.a.     [Download]
>gi|188582340|ref|YP_001925785.1| conjugation TrbI family protein [Methylobacterium populi BJ001]
MSDERDPENEADRKPDGAAQPEAVDEKDDQPLTGEPVAPMRLRPEPPRVTRLSRKVLAGLGLAASLGVGG
ALVYALQTRNGGNQGQELYSTDNRSTPDGLAGLPKDYTGVPKLGPPLPGDLGRPILNAQNGGPSVSTPGG
TAPAPVGPSPEEQRRTQELEAARTARLFASTETRPPNTATAAQPSATATPATDLASLGLAPQPATPSAQD
RQLAFLNQAPDKRTVSPDRVVAPASANVLQAGAVISAALITGIRSDLPGQITAQVTENVYDSPTGKILLV
PQGTRVIGQYDSGVGFGQRRVLLVWNRMIFPNGRSITLERQPGADAEGYAGLEDGVDYHWGELFKAAALS
TLLSVGAEAGSSGQESDIARALRNGASNSVNQTGQQIVQRQLNIAPTLTIRPGFPVRVIVTRDLVLEPYG
G
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|188579286|ref|NC_010725.1|:3319252-3320517 Methylobacterium populi BJ001 chromosome, complete genome
GTGAGCGACGAACGCGATCCGGAGAACGAAGCCGATCGGAAACCCGATGGGGCAGCTCAGCCAGAGGCGG
TCGACGAGAAAGACGACCAGCCGCTCACGGGCGAGCCGGTCGCGCCGATGCGGCTGCGCCCCGAGCCGCC
GCGCGTCACCCGCCTGTCACGCAAGGTGCTGGCGGGCCTCGGCCTGGCAGCGAGCCTGGGCGTCGGTGGC
GCACTGGTCTATGCGCTCCAGACCCGAAACGGCGGCAATCAGGGGCAGGAACTCTATTCCACCGACAACC
GCTCGACACCTGACGGATTGGCGGGTCTGCCGAAGGACTATACCGGCGTGCCCAAACTCGGCCCACCGCT
CCCCGGCGATCTCGGCCGCCCGATCCTCAACGCACAGAACGGCGGGCCATCCGTTTCGACACCGGGAGGT
ACTGCTCCTGCACCAGTCGGCCCCAGCCCGGAGGAGCAGCGTCGAACGCAGGAACTGGAAGCGGCTCGCA
CCGCGCGCCTGTTCGCATCCACGGAGACGCGGCCCCCCAATACCGCGACGGCCGCACAGCCATCCGCGAC
GGCTACCCCCGCAACCGATCTCGCCAGCCTCGGTCTCGCGCCGCAGCCAGCTACACCGTCGGCGCAGGAT
CGGCAGCTCGCCTTCCTCAACCAGGCGCCCGACAAGCGCACCGTCTCGCCCGATCGAGTCGTGGCGCCCG
CCTCGGCCAATGTCCTTCAGGCCGGAGCGGTGATTTCCGCCGCGCTCATCACCGGCATCCGCTCCGATCT
ACCCGGACAGATCACCGCGCAGGTGACGGAAAACGTCTATGACAGCCCCACGGGCAAGATTCTGCTCGTG
CCCCAAGGCACCCGCGTCATCGGGCAATATGATAGCGGCGTCGGCTTCGGCCAGCGGCGTGTGCTGCTCG
TCTGGAACCGGATGATCTTTCCGAACGGCCGCTCGATCACCCTCGAGCGCCAGCCTGGCGCGGACGCCGA
AGGCTATGCCGGGCTGGAGGATGGCGTCGATTACCATTGGGGCGAGCTGTTCAAGGCCGCGGCGCTCTCG
ACGCTGCTCAGCGTCGGCGCCGAGGCCGGCTCATCAGGACAGGAAAGCGACATCGCCCGCGCGCTGCGCA
ATGGTGCGTCCAACAGCGTCAACCAGACCGGTCAGCAGATCGTGCAACGCCAGCTCAACATCGCACCAAC
GCTCACCATCCGTCCGGGCTTCCCCGTTCGCGTCATCGTTACGCGCGACCTTGTTCTCGAACCCTACGGA
GGCTGA
 Primer design